Clone Sequence Records
BO16269.5prime Sequence
242 bp (242 high quality bases) assembled on 2006-10-13
> BO16269.5prime
GAAGTTATCAGTCGACATGGCGGATCCGAGTATCAATGACATCGATGAGA
CTGTGGCTCCTCCCCTCGGAGGCGCTGACAGCTTCGACCTGAACAAGCGG
CTAGATTGCGAGCATTTAGATCAGATGACGGATAATTGGACCGATTATCA
AAGACCCTCGTTTGCCACCGAACTTCTGCGATTTTTCGGCAACGTATTTG
TCGATATATTTAATGCGATTTTCAACGCAAGCTTTCTAGACC
BO16269.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:06:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30192-PA | 213 | CG30192-RA | 1..210 | 17..226 | 1050 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 18:31:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30192-RA | 373 | CG30192-RA | 86..296 | 16..226 | 1055 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 18:31:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 23138674..23138777 | 16..119 | 520 | 100 | Plus |
2R | 25286936 | 2R | 23138842..23138924 | 118..200 | 415 | 100 | Plus |
Blast to na_te.dros performed 2015-02-02 18:31:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3S18 | 6126 | 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). | 3970..4004 | 151..185 | 112 | 80 | Plus |
BO16269.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:47:42 Download gff for
BO16269.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30192-PA | 1..213 | 17..229 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 15:42:51 Download gff for
BO16269.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30192-RA | 82..302 | 8..233 | 96 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 19:16:07 Download gff for
BO16269.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30192-RA | 82..302 | 8..233 | 96 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 19:16:07 Download gff for
BO16269.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23138844..23138924 | 120..200 | 100 | -> | Plus |
2R | 23138670..23138777 | 8..119 | 96 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 15:42:51 Download gff for
BO16269.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 19026193..19026300 | 8..119 | 96 | -> | Plus |
arm_2R | 19026367..19026447 | 120..200 | 100 | -> | Plus |
BO16269.3prime Sequence
242 bp (242 high quality bases) assembled on 2006-10-13
> BO16269.3prime
ATGGTCTAGAAAGCTTGCGTTGAAAATCGCATTAAATATATCGACAAATA
CGTTGCCGAAAAATCGCAGAAGTTCGGTGGCAAACGAGGGTCTTTGATAA
TCGGTCCAATTATCCGTCATCTGATCTAAATGCTCGCAATCTAGCCGCTT
GTTCAGGTCGAAGCTGTCAGCGCCTCCGAGGGGAGGAGCCACAGTCTCAT
CGATGTCATTGATACTCGGATCCGCCATGTCGACTGATAACT
BO16269.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:06:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30192-PA | 213 | CG30192-RA | 1..210 | 228..19 | 1050 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:36:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30192-RA | 373 | CG30192-RA | 86..296 | 229..19 | 1055 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:36:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 23138674..23138777 | 229..126 | 520 | 100 | Minus |
2R | 25286936 | 2R | 23138842..23138924 | 127..45 | 415 | 100 | Minus |
Blast to na_te.dros performed 2015-02-10 16:36:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3S18 | 6126 | 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). | 3970..4004 | 94..60 | 112 | 80 | Minus |
BO16269.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:47:42 Download gff for
BO16269.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30192-PA | 1..213 | 16..228 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-19 20:14:51 Download gff for
BO16269.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30192-RA | 82..302 | 12..237 | 96 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:48:40 Download gff for
BO16269.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30192-RA | 82..302 | 12..237 | 96 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:48:40 Download gff for
BO16269.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23138670..23138777 | 126..237 | 96 | -> | Minus |
2R | 23138844..23138924 | 45..125 | 100 | -> | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 20:14:51 Download gff for
BO16269.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 19026367..19026447 | 45..125 | 100 | -> | Minus |
arm_2R | 19026193..19026300 | 126..237 | 96 | -> | Minus |
BO16269.complete Sequence
244 bp assembled on 2006-10-11
GenBank Submission: FJ633763
> BO16269.complete
GAAGTTATCAGTCGACATGGCGGATCCGAGTATCAATGACATCGATGAGA
CTGTGGCTCCTCCCCTCGGAGGCGCTGACAGCTTCGACCTGAACAAGCGG
CTAGATTGCGAGCATTTAGATCAGATGACGGATAATTGGACCGATTATCA
AAGACCCTCGTTTGCCACCGAACTTCTGCGATTTTTCGGCAACGTATTTG
TCGATATATTTAATGCGATTTTCAACGCAAGCTTTCTAGACCAT
BO16269.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:52:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30192-RA | 213 | CG30192-PA | 1..210 | 17..226 | 1050 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:52:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30192-RA | 373 | CG30192-RA | 86..296 | 16..226 | 1055 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:52:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 23138674..23138777 | 16..119 | 520 | 100 | Plus |
2R | 25286936 | 2R | 23138842..23138924 | 118..200 | 415 | 100 | Plus |
Blast to na_te.dros performed 2014-11-27 00:52:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3S18 | 6126 | 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). | 3970..4004 | 151..185 | 112 | 80 | Plus |
BO16269.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:30:15 Download gff for
BO16269.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30192-RA | 1..213 | 17..229 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:48:34 Download gff for
BO16269.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30192-RA | 91..311 | 8..233 | 96 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:37:04 Download gff for
BO16269.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30192-RA | 87..296 | 17..228 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:30:15 Download gff for
BO16269.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30192-RA | 91..311 | 8..233 | 96 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:12:12 Download gff for
BO16269.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30192-RA | 87..296 | 17..228 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:12:12 Download gff for
BO16269.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23138675..23138777 | 17..119 | 100 | -> | Plus |
2R | 23138844..23138924 | 120..200 | 100 | -> | Plus |
2R | 23138983..23139008 | 201..228 | 92 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:37:04 Download gff for
BO16269.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 19026367..19026447 | 120..200 | 100 | -> | Plus |
arm_2R | 19026506..19026531 | 201..228 | 92 | | Plus |
arm_2R | 19026198..19026300 | 17..119 | 100 | -> | Plus |
BO16269.pep Sequence
Translation from 16 to 244
> BO16269.pep
MADPSINDIDETVAPPLGGADSFDLNKRLDCEHLDQMTDNWTDYQRPSFA
TELLRFFGNVFVDIFNAIFNASFLDH
BO16269.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:48:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30192-PA | 70 | CG30192-PA | 1..70 | 1..70 | 378 | 100 | Plus |