Clone BO16269 Report

Search the DGRC for BO16269

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:162
Well:69
Vector:pDNR-Dual
Associated Gene/TranscriptCG30192-RA
Protein status:BO16269.pep: validated full length
Sequenced Size:244

Clone Sequence Records

BO16269.5prime Sequence

242 bp (242 high quality bases) assembled on 2006-10-13

> BO16269.5prime
GAAGTTATCAGTCGACATGGCGGATCCGAGTATCAATGACATCGATGAGA
CTGTGGCTCCTCCCCTCGGAGGCGCTGACAGCTTCGACCTGAACAAGCGG
CTAGATTGCGAGCATTTAGATCAGATGACGGATAATTGGACCGATTATCA
AAGACCCTCGTTTGCCACCGAACTTCTGCGATTTTTCGGCAACGTATTTG
TCGATATATTTAATGCGATTTTCAACGCAAGCTTTCTAGACC

BO16269.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG30192-PA 213 CG30192-RA 1..210 17..226 1050 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 18:31:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG30192-RA 373 CG30192-RA 86..296 16..226 1055 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 18:31:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23138674..23138777 16..119 520 100 Plus
2R 25286936 2R 23138842..23138924 118..200 415 100 Plus
Blast to na_te.dros performed 2015-02-02 18:31:51
Subject Length Description Subject Range Query Range Score Percent Strand
3S18 6126 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). 3970..4004 151..185 112 80 Plus

BO16269.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:47:42 Download gff for BO16269.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30192-PA 1..213 17..229 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 15:42:51 Download gff for BO16269.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 82..302 8..233 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 19:16:07 Download gff for BO16269.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 82..302 8..233 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 19:16:07 Download gff for BO16269.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 23138844..23138924 120..200 100 -> Plus
2R 23138670..23138777 8..119 96 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 15:42:51 Download gff for BO16269.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19026193..19026300 8..119 96 -> Plus
arm_2R 19026367..19026447 120..200 100 -> Plus

BO16269.3prime Sequence

242 bp (242 high quality bases) assembled on 2006-10-13

> BO16269.3prime
ATGGTCTAGAAAGCTTGCGTTGAAAATCGCATTAAATATATCGACAAATA
CGTTGCCGAAAAATCGCAGAAGTTCGGTGGCAAACGAGGGTCTTTGATAA
TCGGTCCAATTATCCGTCATCTGATCTAAATGCTCGCAATCTAGCCGCTT
GTTCAGGTCGAAGCTGTCAGCGCCTCCGAGGGGAGGAGCCACAGTCTCAT
CGATGTCATTGATACTCGGATCCGCCATGTCGACTGATAACT

BO16269.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG30192-PA 213 CG30192-RA 1..210 228..19 1050 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG30192-RA 373 CG30192-RA 86..296 229..19 1055 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:36:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23138674..23138777 229..126 520 100 Minus
2R 25286936 2R 23138842..23138924 127..45 415 100 Minus
Blast to na_te.dros performed 2015-02-10 16:36:44
Subject Length Description Subject Range Query Range Score Percent Strand
3S18 6126 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). 3970..4004 94..60 112 80 Minus

BO16269.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:47:42 Download gff for BO16269.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30192-PA 1..213 16..228 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-19 20:14:51 Download gff for BO16269.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 82..302 12..237 96   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:48:40 Download gff for BO16269.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 82..302 12..237 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:48:40 Download gff for BO16269.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 23138670..23138777 126..237 96 -> Minus
2R 23138844..23138924 45..125 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 20:14:51 Download gff for BO16269.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19026367..19026447 45..125 100 -> Minus
arm_2R 19026193..19026300 126..237 96 -> Minus

BO16269.complete Sequence

244 bp assembled on 2006-10-11

GenBank Submission: FJ633763

> BO16269.complete
GAAGTTATCAGTCGACATGGCGGATCCGAGTATCAATGACATCGATGAGA
CTGTGGCTCCTCCCCTCGGAGGCGCTGACAGCTTCGACCTGAACAAGCGG
CTAGATTGCGAGCATTTAGATCAGATGACGGATAATTGGACCGATTATCA
AAGACCCTCGTTTGCCACCGAACTTCTGCGATTTTTCGGCAACGTATTTG
TCGATATATTTAATGCGATTTTCAACGCAAGCTTTCTAGACCAT

BO16269.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:52:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG30192-RA 213 CG30192-PA 1..210 17..226 1050 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG30192-RA 373 CG30192-RA 86..296 16..226 1055 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:52:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23138674..23138777 16..119 520 100 Plus
2R 25286936 2R 23138842..23138924 118..200 415 100 Plus
Blast to na_te.dros performed 2014-11-27 00:52:37
Subject Length Description Subject Range Query Range Score Percent Strand
3S18 6126 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). 3970..4004 151..185 112 80 Plus

BO16269.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:30:15 Download gff for BO16269.complete
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 1..213 17..229 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:48:34 Download gff for BO16269.complete
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 91..311 8..233 96   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:37:04 Download gff for BO16269.complete
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 87..296 17..228 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:30:15 Download gff for BO16269.complete
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 91..311 8..233 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:12:12 Download gff for BO16269.complete
Subject Subject Range Query Range Percent Splice Strand
CG30192-RA 87..296 17..228 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:12:12 Download gff for BO16269.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23138675..23138777 17..119 100 -> Plus
2R 23138844..23138924 120..200 100 -> Plus
2R 23138983..23139008 201..228 92   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:37:04 Download gff for BO16269.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19026367..19026447 120..200 100 -> Plus
arm_2R 19026506..19026531 201..228 92   Plus
arm_2R 19026198..19026300 17..119 100 -> Plus

BO16269.pep Sequence

Translation from 16 to 244

> BO16269.pep
MADPSINDIDETVAPPLGGADSFDLNKRLDCEHLDQMTDNWTDYQRPSFA
TELLRFFGNVFVDIFNAIFNASFLDH

BO16269.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:48:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG30192-PA 70 CG30192-PA 1..70 1..70 378 100 Plus