Clone BO16270 Report

Search the DGRC for BO16270

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:162
Well:70
Vector:pDNR-Dual
Associated Gene/TranscriptTom7-RA
Protein status:BO16270.pep:
Sequenced Size:196

Clone Sequence Records

BO16270.5prime Sequence

194 bp (194 high quality bases) assembled on 2006-10-13

> BO16270.5prime
GAAGTTATCAGTCGACATGAAGCTATCCGAGGGAGTTAAGGATCGTTTGG
GATTTGTGGTTGGAGTCGTCCAGACTGGATTCCACTGGGGATTCGTGCCT
CTTGTGCTGTATTTGGGATTTATGAAGGGAGCTGAGCCTGGCATGCCGCC
TCTGAACCTTTTCAGTCTGTTATGGCAGGCAAGCTTTCTAGACC

BO16270.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:46:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG8226-PA 165 Tom7-RA 1..162 17..178 810 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 11:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
Tom7-RB 539 CG8226-RB 195..360 13..178 815 99.4 Plus
Tom7-RA 355 CG8226-RA 73..238 13..178 815 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 11:13:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8951789..8951893 13..117 510 99 Plus
2R 25286936 2R 8952001..8952063 116..178 315 100 Plus
Blast to na_te.dros performed on 2015-02-06 11:13:12 has no hits.

BO16270.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:47:44 Download gff for BO16270.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8226-PA 1..165 17..182 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 04:00:19 Download gff for BO16270.5prime
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 63..241 2..182 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:31:19 Download gff for BO16270.5prime
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 63..241 2..182 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:31:19 Download gff for BO16270.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 8951779..8951892 2..116 95 -> Plus
2R 8952002..8952066 117..182 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 04:00:19 Download gff for BO16270.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4839284..4839397 2..116 95 -> Plus
arm_2R 4839507..4839571 117..182 96   Plus

BO16270.3prime Sequence

194 bp (194 high quality bases) assembled on 2006-10-13

> BO16270.3prime
ATGGTCTAGAAAGCTTGCCTGCCATAACAGACTGAAAAGGTTCAGAGGCG
GCATGCCAGGCTCAGCTCCCTTCATAAATCCCAAATACAGCACAAGAGGC
ACGAATCCCCAGTGGAATCCAGTCTGGACGACTCCAACCACAAATCCCAA
ACGATCCTTAACTCCCTCGGATAGCTTCATGTCGACTGATAACT

BO16270.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:46:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG8226-PA 165 Tom7-RA 1..162 180..19 810 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 12:02:03
Subject Length Description Subject Range Query Range Score Percent Strand
Tom7-RB 539 CG8226-RB 195..360 184..19 815 99.4 Minus
Tom7-RA 355 CG8226-RA 73..238 184..19 815 99.4 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 12:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8951789..8951893 184..80 510 99 Minus
2R 25286936 2R 8952001..8952063 81..19 315 100 Minus
Blast to na_te.dros performed on 2015-02-12 12:02:00 has no hits.

BO16270.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:47:43 Download gff for BO16270.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8226-PA 1..165 15..180 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:24:38 Download gff for BO16270.3prime
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 63..241 15..194 96   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:49:32 Download gff for BO16270.3prime
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 63..241 15..194 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:49:32 Download gff for BO16270.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 8951779..8951892 81..194 95 -> Minus
2R 8952002..8952066 15..80 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:24:38 Download gff for BO16270.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4839284..4839397 81..194 95 -> Minus
arm_2R 4839507..4839571 15..80 96   Minus

BO16270.complete Sequence

196 bp assembled on 2007-12-19

GenBank Submission: FJ633764

> BO16270.complete
GAAGTTATCAGTCGACATGAAGCTATCCGAGGGAGTTAAGGATCGTTTGG
GATTTGTGGTTGGAGTCGTCCAGACTGGATTCCACTGGGGATTCGTGCCT
CTTGTGCTGTATTTGGGATTTATGAAGGGAGCTGAGCCTGGCATGCCGCC
TCTGAACCTTTTCAGTCTGTTATGGCAGGCAAGCTTTCTAGACCAT

BO16270.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:19:48
Subject Length Description Subject Range Query Range Score Percent Strand
Tom7-RB 165 CG8226-PB 1..162 17..178 810 100 Plus
Tom7-RA 165 CG8226-PA 1..162 17..178 810 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:19:49
Subject Length Description Subject Range Query Range Score Percent Strand
Tom7-RB 539 CG8226-RB 195..360 13..178 815 99.4 Plus
Tom7-RA 355 CG8226-RA 73..238 13..178 815 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:19:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8951789..8951893 13..117 510 99 Plus
2R 25286936 2R 8952001..8952063 116..178 315 100 Plus
Blast to na_te.dros performed on 2014-11-27 14:19:47 has no hits.

BO16270.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:03:02 Download gff for BO16270.complete
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 1..165 17..182 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-28 15:37:10 Download gff for BO16270.complete
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 106..267 17..180 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:40:04 Download gff for BO16270.complete
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 77..238 17..180 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:03:03 Download gff for BO16270.complete
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 92..270 2..182 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:08:52 Download gff for BO16270.complete
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 77..238 17..180 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:08:52 Download gff for BO16270.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8951793..8951892 17..116 100 -> Plus
2R 8952002..8952063 117..180 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:40:04 Download gff for BO16270.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4839298..4839397 17..116 100 -> Plus
arm_2R 4839507..4839568 117..180 96   Plus

BO16270.pep Sequence

Translation from 16 to 196

> BO16270.pep
MKLSEGVKDRLGFVVGVVQTGFHWGFVPLVLYLGFMKGAEPGMPPLNLFS
LLWQASFLDH

BO16270.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
Tom7-PB 54 CG8226-PB 1..54 1..54 291 100 Plus
Tom7-PA 54 CG8226-PA 1..54 1..54 291 100 Plus