Clone Sequence Records
BO16270.5prime Sequence
194 bp (194 high quality bases) assembled on 2006-10-13
> BO16270.5prime
GAAGTTATCAGTCGACATGAAGCTATCCGAGGGAGTTAAGGATCGTTTGG
GATTTGTGGTTGGAGTCGTCCAGACTGGATTCCACTGGGGATTCGTGCCT
CTTGTGCTGTATTTGGGATTTATGAAGGGAGCTGAGCCTGGCATGCCGCC
TCTGAACCTTTTCAGTCTGTTATGGCAGGCAAGCTTTCTAGACC
BO16270.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:46:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8226-PA | 165 | Tom7-RA | 1..162 | 17..178 | 810 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 11:13:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Tom7-RB | 539 | CG8226-RB | 195..360 | 13..178 | 815 | 99.4 | Plus |
Tom7-RA | 355 | CG8226-RA | 73..238 | 13..178 | 815 | 99.4 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 11:13:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8951789..8951893 | 13..117 | 510 | 99 | Plus |
2R | 25286936 | 2R | 8952001..8952063 | 116..178 | 315 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-06 11:13:12 has no hits.
BO16270.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:47:44 Download gff for
BO16270.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8226-PA | 1..165 | 17..182 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 04:00:19 Download gff for
BO16270.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Tom7-RA | 63..241 | 2..182 | 96 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:31:19 Download gff for
BO16270.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Tom7-RA | 63..241 | 2..182 | 96 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:31:19 Download gff for
BO16270.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8951779..8951892 | 2..116 | 95 | -> | Plus |
2R | 8952002..8952066 | 117..182 | 96 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 04:00:19 Download gff for
BO16270.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4839284..4839397 | 2..116 | 95 | -> | Plus |
arm_2R | 4839507..4839571 | 117..182 | 96 | | Plus |
BO16270.3prime Sequence
194 bp (194 high quality bases) assembled on 2006-10-13
> BO16270.3prime
ATGGTCTAGAAAGCTTGCCTGCCATAACAGACTGAAAAGGTTCAGAGGCG
GCATGCCAGGCTCAGCTCCCTTCATAAATCCCAAATACAGCACAAGAGGC
ACGAATCCCCAGTGGAATCCAGTCTGGACGACTCCAACCACAAATCCCAA
ACGATCCTTAACTCCCTCGGATAGCTTCATGTCGACTGATAACT
BO16270.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:46:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8226-PA | 165 | Tom7-RA | 1..162 | 180..19 | 810 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 12:02:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Tom7-RB | 539 | CG8226-RB | 195..360 | 184..19 | 815 | 99.4 | Minus |
Tom7-RA | 355 | CG8226-RA | 73..238 | 184..19 | 815 | 99.4 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 12:01:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8951789..8951893 | 184..80 | 510 | 99 | Minus |
2R | 25286936 | 2R | 8952001..8952063 | 81..19 | 315 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-12 12:02:00 has no hits.
BO16270.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:47:43 Download gff for
BO16270.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8226-PA | 1..165 | 15..180 | 98 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:24:38 Download gff for
BO16270.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Tom7-RA | 63..241 | 15..194 | 96 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:49:32 Download gff for
BO16270.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Tom7-RA | 63..241 | 15..194 | 96 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:49:32 Download gff for
BO16270.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8951779..8951892 | 81..194 | 95 | -> | Minus |
2R | 8952002..8952066 | 15..80 | 96 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:24:38 Download gff for
BO16270.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4839284..4839397 | 81..194 | 95 | -> | Minus |
arm_2R | 4839507..4839571 | 15..80 | 96 | | Minus |
BO16270.complete Sequence
196 bp assembled on 2007-12-19
GenBank Submission: FJ633764
> BO16270.complete
GAAGTTATCAGTCGACATGAAGCTATCCGAGGGAGTTAAGGATCGTTTGG
GATTTGTGGTTGGAGTCGTCCAGACTGGATTCCACTGGGGATTCGTGCCT
CTTGTGCTGTATTTGGGATTTATGAAGGGAGCTGAGCCTGGCATGCCGCC
TCTGAACCTTTTCAGTCTGTTATGGCAGGCAAGCTTTCTAGACCAT
BO16270.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:19:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Tom7-RB | 165 | CG8226-PB | 1..162 | 17..178 | 810 | 100 | Plus |
Tom7-RA | 165 | CG8226-PA | 1..162 | 17..178 | 810 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:19:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Tom7-RB | 539 | CG8226-RB | 195..360 | 13..178 | 815 | 99.4 | Plus |
Tom7-RA | 355 | CG8226-RA | 73..238 | 13..178 | 815 | 99.4 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:19:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8951789..8951893 | 13..117 | 510 | 99 | Plus |
2R | 25286936 | 2R | 8952001..8952063 | 116..178 | 315 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 14:19:47 has no hits.
BO16270.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:03:02 Download gff for
BO16270.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Tom7-RA | 1..165 | 17..182 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-28 15:37:10 Download gff for
BO16270.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Tom7-RA | 106..267 | 17..180 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:40:04 Download gff for
BO16270.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Tom7-RA | 77..238 | 17..180 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:03:03 Download gff for
BO16270.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Tom7-RA | 92..270 | 2..182 | 96 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:08:52 Download gff for
BO16270.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Tom7-RA | 77..238 | 17..180 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:08:52 Download gff for
BO16270.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8951793..8951892 | 17..116 | 100 | -> | Plus |
2R | 8952002..8952063 | 117..180 | 96 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:40:04 Download gff for
BO16270.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4839298..4839397 | 17..116 | 100 | -> | Plus |
arm_2R | 4839507..4839568 | 117..180 | 96 | | Plus |
BO16270.pep Sequence
Translation from 16 to 196
> BO16270.pep
MKLSEGVKDRLGFVVGVVQTGFHWGFVPLVLYLGFMKGAEPGMPPLNLFS
LLWQASFLDH
BO16270.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:22:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Tom7-PB | 54 | CG8226-PB | 1..54 | 1..54 | 291 | 100 | Plus |
Tom7-PA | 54 | CG8226-PA | 1..54 | 1..54 | 291 | 100 | Plus |