Clone Sequence Records
BO16274.3prime Sequence
320 bp (320 high quality bases) assembled on 2006-10-13
> BO16274.3prime
ATGGTCTAGAAAGCTTGCTTTCTTCTCCTTGTCCTTTTCCTCTTGTGGTG
GAGGCTCCTCCGCCTGCTCGTCCTCCTCCGGCGGAAGTCCCAAATGCATC
CTCGACCATCGGGGCAGGCTGAAGAGGCAGTAGAAGGGAATGATCATCAT
GACAACCAAGGAACCGCAACCAAAGATCAAACGCTGCGCTGAACTCATCG
GAAATCGAGGAGGACCGGCCATGGGAATATAGTTCCGACCCATGGACGAT
CGGAGCTTAAGGGTCCCCATCTCGTTCAGATGTTTGCGTATTAAAGAAAT
ACTCATGTCGACTGATAACT
BO16274.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:47:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12617-PA | 291 | CG12617-RA | 1..288 | 306..19 | 1440 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:13:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12617-RC | 1022 | CG12617-RC | 102..391 | 308..19 | 1450 | 100 | Minus |
CG12617-RB | 569 | CG12617-RB | 102..391 | 308..19 | 1450 | 100 | Minus |
CG12617-RA | 538 | CG12617-RA | 102..391 | 308..19 | 1450 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 22:13:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 20294884..20295173 | 308..19 | 1450 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-10 22:13:22 has no hits.
BO16274.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:47:49 Download gff for
BO16274.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12617-PA | 1..291 | 18..306 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 07:44:06 Download gff for
BO16274.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12617-RA | 90..383 | 19..313 | 99 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:53:54 Download gff for
BO16274.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12617-RA | 98..391 | 19..313 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:53:54 Download gff for
BO16274.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 20294880..20295173 | 19..313 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 07:44:06 Download gff for
BO16274.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 20294880..20295173 | 19..313 | 99 | | Minus |
BO16274.complete Sequence
322 bp assembled on 2008-08-15
GenBank Submission: FJ633765
> BO16274.complete
GAAGTTATCAGTCGACATGAGTATTTCTTTAATACGCAAACATCTGAACG
AGATGGGGACCCTTAAGCTCCGATCGTCCATGGGTCGGAACTATATTCCC
ATGGCCGGTCCTCCTCGATTTCCGATGAGTTCAGCGCAGCGTTTGATCTT
TGGTTGCGGTTCCTTGGTTGTCATGATGATCATTCCCTTCTACTGCCTCT
TCAGCCTGCCCCGATGGTCGAGGATGCATTTGGGACTTCCGCCGGAGGAG
GACGAGCAGGCGGAGGAGCCTCCACCACAAGAGGAAAAGGACAAGGAGAA
GAAAGCAAGCTTTCTAGACCAT
BO16274.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:10:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12617-RC | 291 | CG12617-PC | 1..288 | 17..304 | 1440 | 100 | Plus |
CG12617-RB | 291 | CG12617-PB | 1..288 | 17..304 | 1440 | 100 | Plus |
CG12617-RA | 291 | CG12617-PA | 1..288 | 17..304 | 1440 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:10:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12617-RC | 1022 | CG12617-RC | 102..391 | 15..304 | 1450 | 100 | Plus |
CG12617-RB | 569 | CG12617-RB | 102..391 | 15..304 | 1450 | 100 | Plus |
CG12617-RA | 538 | CG12617-RA | 102..391 | 15..304 | 1450 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:10:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 20294884..20295173 | 15..304 | 1450 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 15:10:13 has no hits.
BO16274.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:44:39 Download gff for
BO16274.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12617-RA | 84..377 | 10..304 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:38:03 Download gff for
BO16274.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12617-RA | 96..383 | 17..306 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 10:58:42 Download gff for
BO16274.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12617-RA | 90..377 | 17..306 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:01:27 Download gff for
BO16274.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12617-RA | 104..391 | 17..306 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:01:27 Download gff for
BO16274.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 20294886..20295173 | 17..306 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:38:03 Download gff for
BO16274.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 20294886..20295173 | 17..306 | 99 | | Plus |
BO16274.pep Sequence
Translation from 16 to 322
> BO16274.pep
MSISLIRKHLNEMGTLKLRSSMGRNYIPMAGPPRFPMSSAQRLIFGCGSL
VVMMIIPFYCLFSLPRWSRMHLGLPPEEDEQAEEPPPQEEKDKEKKASFL
DH
BO16274.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:41:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12617-PC | 96 | CG12617-PC | 1..96 | 1..96 | 510 | 100 | Plus |
CG12617-PB | 96 | CG12617-PB | 1..96 | 1..96 | 510 | 100 | Plus |
CG12617-PA | 96 | CG12617-PA | 1..96 | 1..96 | 510 | 100 | Plus |