Clone BO16274 Report

Search the DGRC for BO16274

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:162
Well:74
Vector:pDNR-Dual
Associated Gene/TranscriptCG12617-RA
Protein status:BO16274.pep: Imported from assembly
Sequenced Size:322

Clone Sequence Records

BO16274.3prime Sequence

320 bp (320 high quality bases) assembled on 2006-10-13

> BO16274.3prime
ATGGTCTAGAAAGCTTGCTTTCTTCTCCTTGTCCTTTTCCTCTTGTGGTG
GAGGCTCCTCCGCCTGCTCGTCCTCCTCCGGCGGAAGTCCCAAATGCATC
CTCGACCATCGGGGCAGGCTGAAGAGGCAGTAGAAGGGAATGATCATCAT
GACAACCAAGGAACCGCAACCAAAGATCAAACGCTGCGCTGAACTCATCG
GAAATCGAGGAGGACCGGCCATGGGAATATAGTTCCGACCCATGGACGAT
CGGAGCTTAAGGGTCCCCATCTCGTTCAGATGTTTGCGTATTAAAGAAAT
ACTCATGTCGACTGATAACT

BO16274.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:47:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG12617-PA 291 CG12617-RA 1..288 306..19 1440 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG12617-RC 1022 CG12617-RC 102..391 308..19 1450 100 Minus
CG12617-RB 569 CG12617-RB 102..391 308..19 1450 100 Minus
CG12617-RA 538 CG12617-RA 102..391 308..19 1450 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 22:13:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20294884..20295173 308..19 1450 100 Minus
Blast to na_te.dros performed on 2015-02-10 22:13:22 has no hits.

BO16274.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:47:49 Download gff for BO16274.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12617-PA 1..291 18..306 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 07:44:06 Download gff for BO16274.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12617-RA 90..383 19..313 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:53:54 Download gff for BO16274.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12617-RA 98..391 19..313 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:53:54 Download gff for BO16274.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 20294880..20295173 19..313 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 07:44:06 Download gff for BO16274.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20294880..20295173 19..313 99   Minus

BO16274.complete Sequence

322 bp assembled on 2008-08-15

GenBank Submission: FJ633765

> BO16274.complete
GAAGTTATCAGTCGACATGAGTATTTCTTTAATACGCAAACATCTGAACG
AGATGGGGACCCTTAAGCTCCGATCGTCCATGGGTCGGAACTATATTCCC
ATGGCCGGTCCTCCTCGATTTCCGATGAGTTCAGCGCAGCGTTTGATCTT
TGGTTGCGGTTCCTTGGTTGTCATGATGATCATTCCCTTCTACTGCCTCT
TCAGCCTGCCCCGATGGTCGAGGATGCATTTGGGACTTCCGCCGGAGGAG
GACGAGCAGGCGGAGGAGCCTCCACCACAAGAGGAAAAGGACAAGGAGAA
GAAAGCAAGCTTTCTAGACCAT

BO16274.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:10:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG12617-RC 291 CG12617-PC 1..288 17..304 1440 100 Plus
CG12617-RB 291 CG12617-PB 1..288 17..304 1440 100 Plus
CG12617-RA 291 CG12617-PA 1..288 17..304 1440 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:10:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG12617-RC 1022 CG12617-RC 102..391 15..304 1450 100 Plus
CG12617-RB 569 CG12617-RB 102..391 15..304 1450 100 Plus
CG12617-RA 538 CG12617-RA 102..391 15..304 1450 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20294884..20295173 15..304 1450 100 Plus
Blast to na_te.dros performed on 2014-11-27 15:10:13 has no hits.

BO16274.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:44:39 Download gff for BO16274.complete
Subject Subject Range Query Range Percent Splice Strand
CG12617-RA 84..377 10..304 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:38:03 Download gff for BO16274.complete
Subject Subject Range Query Range Percent Splice Strand
CG12617-RA 96..383 17..306 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 10:58:42 Download gff for BO16274.complete
Subject Subject Range Query Range Percent Splice Strand
CG12617-RA 90..377 17..306 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:01:27 Download gff for BO16274.complete
Subject Subject Range Query Range Percent Splice Strand
CG12617-RA 104..391 17..306 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:01:27 Download gff for BO16274.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20294886..20295173 17..306 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:38:03 Download gff for BO16274.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20294886..20295173 17..306 99   Plus

BO16274.pep Sequence

Translation from 16 to 322

> BO16274.pep
MSISLIRKHLNEMGTLKLRSSMGRNYIPMAGPPRFPMSSAQRLIFGCGSL
VVMMIIPFYCLFSLPRWSRMHLGLPPEEDEQAEEPPPQEEKDKEKKASFL
DH

BO16274.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:41:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG12617-PC 96 CG12617-PC 1..96 1..96 510 100 Plus
CG12617-PB 96 CG12617-PB 1..96 1..96 510 100 Plus
CG12617-PA 96 CG12617-PA 1..96 1..96 510 100 Plus