Clone Sequence Records
BO16281.3prime Sequence
299 bp (299 high quality bases) assembled on 2006-10-13
> BO16281.3prime
ATGGTCTAGAAAGCTTGCTTCGTCGTTCGCGTAGTCAGCGGGGTTCTTGC
GCAGCAGGGCGGTGTGCTTGCGTTCGGTCAGATCGTAGATCAGGTATCCC
ACGATGAAGGGGGGAGTAACGATGAAGACGTTGGAGCGGAAGCGACGCAC
CATGTTGGGCAGTCCCTTGCTGATCGCTCCAGCGAAGGCGCGCTGCTCGA
AGGGCGACAGCTTGTAGGTGACGATGCCGTGCACCTTGGCCAAGTTGCCA
AAATGCTGGCCATTCAGGATCGAGGATAGACGCATGTCGACTGATAACT
BO16281.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:06:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7580-PA | 270 | CG7580-RA | 1..267 | 285..19 | 1335 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:59:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7580-RD | 425 | CG7580-RD | 97..364 | 286..19 | 1340 | 100 | Minus |
CG7580-RC | 625 | CG7580-RC | 297..564 | 286..19 | 1340 | 100 | Minus |
CG7580-RB | 746 | CG7580-RB | 97..364 | 286..19 | 1340 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:59:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 17475419..17475594 | 286..111 | 880 | 100 | Minus |
3L | 28110227 | 3L | 17475651..17475742 | 110..19 | 460 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-10 17:59:10 has no hits.
BO16281.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:47:56 Download gff for
BO16281.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7580-PA | 1..270 | 15..285 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:43:54 Download gff for
BO16281.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7580-RB | 91..369 | 13..293 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 19:09:35 Download gff for
BO16281.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7580-RB | 91..369 | 13..293 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 19:09:35 Download gff for
BO16281.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 17475413..17475594 | 111..293 | 97 | -> | Minus |
3L | 17475651..17475747 | 13..110 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:43:54 Download gff for
BO16281.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 17468513..17468694 | 111..293 | 97 | -> | Minus |
arm_3L | 17468751..17468847 | 13..110 | 97 | | Minus |
BO16281.5prime Sequence
299 bp (299 high quality bases) assembled on 2006-10-13
> BO16281.5prime
GAAGTTATCAGTCGACATGCGTCTATCCTCGATCCTGAATGGCCAGCATT
TTGGCAACTTGGCCAAGGTGCACGGCATCGTCACCTACAAGCTGTCGCCC
TTCGAGCAGCGCGCCTTCGCTGGAGCGATCAGCAAGGGACTGCCCAACAT
GGTGCGTCGCTTCCGCTCCAACGTCTTCATCGTTACTCCCCCCTTCATCG
TGGGATACCTGATCTACGATCTGACCGAACGCAAGCACACCGCCCTGCTG
CGCAAGAACCCCGCTGACTACGCGAACGACGAAGCAAGCTTTCTAGACC
BO16281.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:06:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7580-PA | 270 | CG7580-RA | 1..267 | 17..283 | 1335 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:18:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7580-RD | 425 | CG7580-RD | 97..364 | 16..283 | 1340 | 100 | Plus |
CG7580-RC | 625 | CG7580-RC | 297..564 | 16..283 | 1340 | 100 | Plus |
CG7580-RB | 746 | CG7580-RB | 97..364 | 16..283 | 1340 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:18:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 17475419..17475594 | 16..191 | 880 | 100 | Plus |
3L | 28110227 | 3L | 17475651..17475742 | 192..283 | 460 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-12 11:18:24 has no hits.
BO16281.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:47:57 Download gff for
BO16281.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7580-PA | 1..270 | 17..287 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:47:15 Download gff for
BO16281.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7580-RB | 91..369 | 9..289 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:34:39 Download gff for
BO16281.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7580-RB | 91..369 | 9..289 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:34:39 Download gff for
BO16281.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 17475413..17475594 | 9..191 | 97 | -> | Plus |
3L | 17475651..17475747 | 192..289 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:47:15 Download gff for
BO16281.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 17468513..17468694 | 9..191 | 97 | -> | Plus |
arm_3L | 17468751..17468847 | 192..289 | 97 | | Plus |
BO16281.complete Sequence
301 bp assembled on 2006-10-11
GenBank Submission: FJ633766
> BO16281.complete
GAAGTTATCAGTCGACATGCGTCTATCCTCGATCCTGAATGGCCAGCATT
TTGGCAACTTGGCCAAGGTGCACGGCATCGTCACCTACAAGCTGTCGCCC
TTCGAGCAGCGCGCCTTCGCTGGAGCGATCAGCAAGGGACTGCCCAACAT
GGTGCGTCGCTTCCGCTCCAACGTCTTCATCGTTACTCCCCCCTTCATCG
TGGGATACCTGATCTACGATCTGACCGAACGCAAGCACACCGCCCTGCTG
CGCAAGAACCCCGCTGACTACGCGAACGACGAAGCAAGCTTTCTAGACCA
T
BO16281.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:15:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7580-RD | 270 | CG7580-PD | 1..267 | 17..283 | 1335 | 100 | Plus |
CG7580-RC | 270 | CG7580-PC | 1..267 | 17..283 | 1335 | 100 | Plus |
CG7580-RB | 270 | CG7580-PB | 1..267 | 17..283 | 1335 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:15:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7580-RD | 425 | CG7580-RD | 97..364 | 16..283 | 1340 | 100 | Plus |
CG7580-RC | 625 | CG7580-RC | 297..564 | 16..283 | 1340 | 100 | Plus |
CG7580-RB | 746 | CG7580-RB | 97..364 | 16..283 | 1340 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:15:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 17475419..17475594 | 16..191 | 880 | 100 | Plus |
3L | 28110227 | 3L | 17475651..17475742 | 192..283 | 460 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 13:15:03 has no hits.
BO16281.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:30:17 Download gff for
BO16281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7580-RA | 1..270 | 17..287 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:02:36 Download gff for
BO16281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7580-RA | 320..598 | 9..289 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:28:13 Download gff for
BO16281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7580-RB | 98..364 | 17..285 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:30:17 Download gff for
BO16281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7580-RA | 320..598 | 9..289 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:14:09 Download gff for
BO16281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7580-RB | 98..364 | 17..285 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:14:09 Download gff for
BO16281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 17475420..17475594 | 17..191 | 100 | -> | Plus |
3L | 17475651..17475742 | 192..285 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:28:13 Download gff for
BO16281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 17468520..17468694 | 17..191 | 100 | -> | Plus |
arm_3L | 17468751..17468842 | 192..285 | 97 | | Plus |
BO16281.pep Sequence
Translation from 16 to 301
> BO16281.pep
MRLSSILNGQHFGNLAKVHGIVTYKLSPFEQRAFAGAISKGLPNMVRRFR
SNVFIVTPPFIVGYLIYDLTERKHTALLRKNPADYANDEASFLDH
BO16281.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:47:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7580-PD | 89 | CG7580-PD | 1..89 | 1..89 | 460 | 100 | Plus |
CG7580-PC | 89 | CG7580-PC | 1..89 | 1..89 | 460 | 100 | Plus |
CG7580-PB | 89 | CG7580-PB | 1..89 | 1..89 | 460 | 100 | Plus |
CG7580-PA | 89 | CG7580-PA | 1..89 | 1..89 | 460 | 100 | Plus |