Clone BO16281 Report

Search the DGRC for BO16281

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:162
Well:81
Vector:pDNR-Dual
Associated Gene/TranscriptCG7580-RA
Protein status:BO16281.pep: validated full length
Sequenced Size:301

Clone Sequence Records

BO16281.3prime Sequence

299 bp (299 high quality bases) assembled on 2006-10-13

> BO16281.3prime
ATGGTCTAGAAAGCTTGCTTCGTCGTTCGCGTAGTCAGCGGGGTTCTTGC
GCAGCAGGGCGGTGTGCTTGCGTTCGGTCAGATCGTAGATCAGGTATCCC
ACGATGAAGGGGGGAGTAACGATGAAGACGTTGGAGCGGAAGCGACGCAC
CATGTTGGGCAGTCCCTTGCTGATCGCTCCAGCGAAGGCGCGCTGCTCGA
AGGGCGACAGCTTGTAGGTGACGATGCCGTGCACCTTGGCCAAGTTGCCA
AAATGCTGGCCATTCAGGATCGAGGATAGACGCATGTCGACTGATAACT

BO16281.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:06:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG7580-PA 270 CG7580-RA 1..267 285..19 1335 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:59:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG7580-RD 425 CG7580-RD 97..364 286..19 1340 100 Minus
CG7580-RC 625 CG7580-RC 297..564 286..19 1340 100 Minus
CG7580-RB 746 CG7580-RB 97..364 286..19 1340 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:59:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17475419..17475594 286..111 880 100 Minus
3L 28110227 3L 17475651..17475742 110..19 460 100 Minus
Blast to na_te.dros performed on 2015-02-10 17:59:10 has no hits.

BO16281.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:47:56 Download gff for BO16281.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7580-PA 1..270 15..285 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:43:54 Download gff for BO16281.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7580-RB 91..369 13..293 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 19:09:35 Download gff for BO16281.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7580-RB 91..369 13..293 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 19:09:35 Download gff for BO16281.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 17475413..17475594 111..293 97 -> Minus
3L 17475651..17475747 13..110 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:43:54 Download gff for BO16281.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17468513..17468694 111..293 97 -> Minus
arm_3L 17468751..17468847 13..110 97   Minus

BO16281.5prime Sequence

299 bp (299 high quality bases) assembled on 2006-10-13

> BO16281.5prime
GAAGTTATCAGTCGACATGCGTCTATCCTCGATCCTGAATGGCCAGCATT
TTGGCAACTTGGCCAAGGTGCACGGCATCGTCACCTACAAGCTGTCGCCC
TTCGAGCAGCGCGCCTTCGCTGGAGCGATCAGCAAGGGACTGCCCAACAT
GGTGCGTCGCTTCCGCTCCAACGTCTTCATCGTTACTCCCCCCTTCATCG
TGGGATACCTGATCTACGATCTGACCGAACGCAAGCACACCGCCCTGCTG
CGCAAGAACCCCGCTGACTACGCGAACGACGAAGCAAGCTTTCTAGACC

BO16281.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:06:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG7580-PA 270 CG7580-RA 1..267 17..283 1335 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:18:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG7580-RD 425 CG7580-RD 97..364 16..283 1340 100 Plus
CG7580-RC 625 CG7580-RC 297..564 16..283 1340 100 Plus
CG7580-RB 746 CG7580-RB 97..364 16..283 1340 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17475419..17475594 16..191 880 100 Plus
3L 28110227 3L 17475651..17475742 192..283 460 100 Plus
Blast to na_te.dros performed on 2015-02-12 11:18:24 has no hits.

BO16281.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:47:57 Download gff for BO16281.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7580-PA 1..270 17..287 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:47:15 Download gff for BO16281.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7580-RB 91..369 9..289 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:34:39 Download gff for BO16281.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7580-RB 91..369 9..289 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:34:39 Download gff for BO16281.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 17475413..17475594 9..191 97 -> Plus
3L 17475651..17475747 192..289 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:47:15 Download gff for BO16281.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17468513..17468694 9..191 97 -> Plus
arm_3L 17468751..17468847 192..289 97   Plus

BO16281.complete Sequence

301 bp assembled on 2006-10-11

GenBank Submission: FJ633766

> BO16281.complete
GAAGTTATCAGTCGACATGCGTCTATCCTCGATCCTGAATGGCCAGCATT
TTGGCAACTTGGCCAAGGTGCACGGCATCGTCACCTACAAGCTGTCGCCC
TTCGAGCAGCGCGCCTTCGCTGGAGCGATCAGCAAGGGACTGCCCAACAT
GGTGCGTCGCTTCCGCTCCAACGTCTTCATCGTTACTCCCCCCTTCATCG
TGGGATACCTGATCTACGATCTGACCGAACGCAAGCACACCGCCCTGCTG
CGCAAGAACCCCGCTGACTACGCGAACGACGAAGCAAGCTTTCTAGACCA
T

BO16281.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:15:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG7580-RD 270 CG7580-PD 1..267 17..283 1335 100 Plus
CG7580-RC 270 CG7580-PC 1..267 17..283 1335 100 Plus
CG7580-RB 270 CG7580-PB 1..267 17..283 1335 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:15:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG7580-RD 425 CG7580-RD 97..364 16..283 1340 100 Plus
CG7580-RC 625 CG7580-RC 297..564 16..283 1340 100 Plus
CG7580-RB 746 CG7580-RB 97..364 16..283 1340 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:15:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17475419..17475594 16..191 880 100 Plus
3L 28110227 3L 17475651..17475742 192..283 460 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:15:03 has no hits.

BO16281.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:30:17 Download gff for BO16281.complete
Subject Subject Range Query Range Percent Splice Strand
CG7580-RA 1..270 17..287 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:02:36 Download gff for BO16281.complete
Subject Subject Range Query Range Percent Splice Strand
CG7580-RA 320..598 9..289 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:28:13 Download gff for BO16281.complete
Subject Subject Range Query Range Percent Splice Strand
CG7580-RB 98..364 17..285 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:30:17 Download gff for BO16281.complete
Subject Subject Range Query Range Percent Splice Strand
CG7580-RA 320..598 9..289 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:14:09 Download gff for BO16281.complete
Subject Subject Range Query Range Percent Splice Strand
CG7580-RB 98..364 17..285 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:14:09 Download gff for BO16281.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17475420..17475594 17..191 100 -> Plus
3L 17475651..17475742 192..285 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:28:13 Download gff for BO16281.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17468520..17468694 17..191 100 -> Plus
arm_3L 17468751..17468842 192..285 97   Plus

BO16281.pep Sequence

Translation from 16 to 301

> BO16281.pep
MRLSSILNGQHFGNLAKVHGIVTYKLSPFEQRAFAGAISKGLPNMVRRFR
SNVFIVTPPFIVGYLIYDLTERKHTALLRKNPADYANDEASFLDH

BO16281.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG7580-PD 89 CG7580-PD 1..89 1..89 460 100 Plus
CG7580-PC 89 CG7580-PC 1..89 1..89 460 100 Plus
CG7580-PB 89 CG7580-PB 1..89 1..89 460 100 Plus
CG7580-PA 89 CG7580-PA 1..89 1..89 460 100 Plus