Clone BO16291 Report

Search the DGRC for BO16291

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:162
Well:91
Vector:pDNR-Dual
Associated Gene/TranscriptCG12902-RA
Protein status:BO16291.pep: validated full length
Sequenced Size:226

Clone Sequence Records

BO16291.3prime Sequence

224 bp (224 high quality bases) assembled on 2006-10-13

> BO16291.3prime
ATGGTCTAGAAAGCTTGCCTTCTTGGCCTTGCCTTCGTCCTTCTTTTTGC
CGCCCGACTTGTCGTCCTTGTTGCGCACAAAGAGCACGCCCAGTCCCACG
CCGATGACGAAGAACAGGACGCGGTTGCACGGCGTACAGTTGAGCCTGGC
AAGGAGCGACGGCATCGGCCGGCACACCCTGCGGACCTCGGTACGCTTAC
AACAGGGCATGTCGACTGATAACT

BO16291.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:06:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG12902-PA 195 CG12902-RA 1..192 210..19 910 98.9 Minus
CG12902-PB 195 CG12902-RB 1..192 210..19 910 98.9 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-31 10:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG43397-RB 896 CG43397-RB 387..579 211..19 935 99 Minus
CG43397-RA 1047 CG43397-RA 538..730 211..19 935 99 Minus
CG12902-RC 664 CG12902-RC 155..347 211..19 935 99 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-01-31 10:18:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10355041..10355233 19..211 935 99 Plus
Blast to na_te.dros performed on 2015-01-31 10:18:05 has no hits.

BO16291.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:48:11 Download gff for BO16291.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12902-PB 1..195 18..210 97   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 23:36:27 Download gff for BO16291.3prime
Subject Subject Range Query Range Percent Splice Strand
CG43397-RB 378..579 19..222 96   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-31 12:45:34 Download gff for BO16291.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12902-RC 146..347 19..222 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-31 12:45:34 Download gff for BO16291.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 10355041..10355240 19..222 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 23:36:27 Download gff for BO16291.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6242546..6242745 19..222 96   Plus

BO16291.5prime Sequence

224 bp (224 high quality bases) assembled on 2006-10-13

> BO16291.5prime
GAAGTTATCAGTCGACATGCCCTGTTGTAAGCGTACCGAGGTCCGCAGGG
TGTGCCGGCCGATGCCGTCGCTCCTTGCCAGGCTCAACTGTACGCCGTGC
AACCGCGTCCTGTTCTTCGTCATCGGCGTGGGACTGGGCGTGCTCTTTGT
GCGCAACAAGGACGACAAGTCGGGCGGCAAAAAGAAGGACGAAGGCAAGG
CCAAGAAGGCAAGCTTTCTAGACC

BO16291.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:06:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG12902-PA 195 CG12902-RA 1..192 17..208 910 98.9 Plus
CG12902-PB 195 CG12902-RB 1..192 17..208 910 98.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG43397-RB 896 CG43397-RB 387..579 16..208 935 99 Plus
CG43397-RA 1047 CG43397-RA 538..730 16..208 935 99 Plus
CG12902-RC 664 CG12902-RC 155..347 16..208 935 99 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:45:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10355041..10355233 208..16 935 99 Minus
Blast to na_te.dros performed on 2015-02-10 21:45:43 has no hits.

BO16291.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:48:12 Download gff for BO16291.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12902-PB 1..195 17..209 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 18:07:52 Download gff for BO16291.5prime
Subject Subject Range Query Range Percent Splice Strand
CG43397-RB 378..579 5..208 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:45:57 Download gff for BO16291.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12902-RC 146..347 5..208 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:45:57 Download gff for BO16291.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 10355041..10355240 5..208 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 18:07:52 Download gff for BO16291.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6242546..6242745 5..208 96   Minus

BO16291.complete Sequence

226 bp assembled on 2006-10-11

GenBank Submission: FJ633772

> BO16291.complete
GAAGTTATCAGTCGACATGCCCTGTTGTAAGCGTACCGAGGTCCGCAGGG
TGTGCCGGCCGATGCCGTCGCTCCTTGCCAGGCTCAACTGTACGCCGTGC
AACCGCGTCCTGTTCTTCGTCATCGGCGTGGGACTGGGCGTGCTCTTTGT
GCGCAACAAGGACGACAAGTCGGGCGGCAAAAAGAAGGACGAAGGCAAGG
CCAAGAAGGCAAGCTTTCTAGACCAT

BO16291.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:54:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG12902-RC 195 CG12902-PC 1..192 17..208 930 99 Plus
CG12902-RB 195 CG12902-PB 1..192 17..208 930 99 Plus
CG12902-RA 195 CG12902-PA 1..192 17..208 930 99 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:54:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG43397-RB 896 CG43397-RB 387..579 16..208 935 99 Plus
CG43397-RA 1047 CG43397-RA 538..730 16..208 935 99 Plus
CG12902-RC 664 CG12902-RC 155..347 16..208 935 99 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10355041..10355233 208..16 935 99 Minus
Blast to na_te.dros performed on 2014-11-27 10:54:51 has no hits.

BO16291.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:35:53 Download gff for BO16291.complete
Subject Subject Range Query Range Percent Splice Strand
CG12902-RB 1..195 17..209 97   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:56:58 Download gff for BO16291.complete
Subject Subject Range Query Range Percent Splice Strand
CG12902-RA 529..730 5..208 96   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:42:49 Download gff for BO16291.complete
Subject Subject Range Query Range Percent Splice Strand
CG43397-RB 388..579 17..210 97   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:35:53 Download gff for BO16291.complete
Subject Subject Range Query Range Percent Splice Strand
CG12902-RA 529..730 5..208 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:34:03 Download gff for BO16291.complete
Subject Subject Range Query Range Percent Splice Strand
CG12902-RC 156..347 17..210 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:34:03 Download gff for BO16291.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10355039..10355232 17..210 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:42:49 Download gff for BO16291.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6242544..6242737 17..210 97   Minus

BO16291.pep Sequence

Translation from 16 to 226

> BO16291.pep
MPCCKRTEVRRVCRPMPSLLARLNCTPCNRVLFFVIGVGLGVLFVRNKDD
KSGGKKKDEGKAKKASFLDH

BO16291.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:38:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG12902-PC 64 CG12902-PC 1..64 1..64 345 100 Plus
CG12902-PB 64 CG12902-PB 1..64 1..64 345 100 Plus
CG12902-PA 64 CG12902-PA 1..64 1..64 345 100 Plus