Clone Sequence Records
BO16371.5prime Sequence
188 bp (188 high quality bases) assembled on 2006-10-13
> BO16371.5prime
GAAGTTATCAGTCGACATGTGCAGCTATCCTTGCTATCCTTGCGCCGCCT
TGTGTCCCTGCGGAGGCAGTGGACCAAGTGGATTCTACGATCCGTGCTTT
GGACCCTACAACGGACCATTTAACTCCTGGTGCGGAGCAAGTGGACCCGG
TTTCTGGAGAGGTGGATGTTGCGCAAGCTTTCTAGACC
BO16371.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:58:25
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG31226-PA | 159 | CG31226-RA | 1..156 | 17..172 | 780 | 100 | Plus |
| CG31226-PB | 159 | CG31226-RB | 1..156 | 17..172 | 780 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 12:27:01
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG31226-RB | 384 | CG31226-RB | 91..247 | 16..172 | 785 | 100 | Plus |
| CG31226-RA | 389 | CG31226-RA | 96..252 | 16..172 | 785 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 12:26:55
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 18851495..18851651 | 172..16 | 785 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-12 12:26:58 has no hits.
BO16371.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:49:55 Download gff for
BO16371.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG31226-PB | 1..159 | 17..173 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:29:20 Download gff for
BO16371.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG31226-RA | 86..258 | 7..181 | 95 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 14:13:36 Download gff for
BO16371.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG31226-RA | 86..258 | 7..181 | 95 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 14:13:36 Download gff for
BO16371.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 18851488..18851661 | 7..181 | 95 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:29:20 Download gff for
BO16371.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 14677210..14677383 | 7..181 | 95 | | Minus |
BO16371.3prime Sequence
188 bp (188 high quality bases) assembled on 2006-10-13
> BO16371.3prime
ATGGTCTAGAAAGCTTGCGCAACATCCACCTCTCCAGAAACCGGGTCCAC
TTGCTCCGCACCAGGAGTTAAATGGTCCGTTGTAGGGTCCAAAGCACGGA
TCGTAGAATCCACTTGGTCCACTGCCTCCGCAGGGACACAAGGCGGCGCA
AGGATAGCAAGGATAGCTGCACATGTCGACTGATAACT
BO16371.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:58:20
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG31226-PA | 159 | CG31226-RA | 1..156 | 174..19 | 780 | 100 | Minus |
| CG31226-PB | 159 | CG31226-RB | 1..156 | 174..19 | 780 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:37:25
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG31226-RB | 384 | CG31226-RB | 91..247 | 175..19 | 785 | 100 | Minus |
| CG31226-RA | 389 | CG31226-RA | 96..252 | 175..19 | 785 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:37:16
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 18851495..18851651 | 19..175 | 785 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-10 16:37:20 has no hits.
BO16371.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:49:55 Download gff for
BO16371.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG31226-PB | 1..159 | 18..174 | 98 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-19 23:00:19 Download gff for
BO16371.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG31226-RA | 86..258 | 10..184 | 95 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:51:29 Download gff for
BO16371.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG31226-RA | 86..258 | 10..184 | 95 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:51:29 Download gff for
BO16371.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 18851488..18851661 | 10..184 | 95 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 23:00:19 Download gff for
BO16371.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 14677210..14677383 | 10..184 | 95 | | Plus |
BO16371.complete Sequence
190 bp assembled on 2007-12-19
GenBank Submission: FJ633798
> BO16371.complete
GAAGTTATCAGTCGACATGTGCAGCTATCCTTGCTATCCTTGCGCCGCCT
TGTGTCCCTGCGGAGGCAGTGGACCAAGTGGATTCTACGATCCGTGCTTT
GGACCCTACAACGGACCATTTAACTCCTGGTGCGGAGCAAGTGGACCCGG
TTTCTGGAGAGGTGGATGTTGCGCAAGCTTTCTAGACCAT
BO16371.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 19:41:06
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG31226-RB | 159 | CG31226-PB | 1..156 | 17..172 | 780 | 100 | Plus |
| CG31226-RA | 159 | CG31226-PA | 1..156 | 17..172 | 780 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 19:41:07
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG31226-RB | 384 | CG31226-RB | 91..247 | 16..172 | 785 | 100 | Plus |
| CG31226-RA | 389 | CG31226-RA | 96..252 | 16..172 | 785 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 19:41:04
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 18851495..18851651 | 172..16 | 785 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 19:41:05 has no hits.
BO16371.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:03:05 Download gff for
BO16371.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG31226-RB | 1..159 | 17..173 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-28 15:30:31 Download gff for
BO16371.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG31226-RA | 103..258 | 17..174 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:02:05 Download gff for
BO16371.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG31226-RA | 97..252 | 17..174 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:03:06 Download gff for
BO16371.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG31226-RA | 92..264 | 7..181 | 95 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:06:18 Download gff for
BO16371.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG31226-RA | 97..252 | 17..174 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:06:18 Download gff for
BO16371.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 18851493..18851650 | 17..174 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:02:05 Download gff for
BO16371.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 14677215..14677372 | 17..174 | 98 | | Minus |
BO16371.pep Sequence
Translation from 16 to 190
> BO16371.pep
MCSYPCYPCAALCPCGGSGPSGFYDPCFGPYNGPFNSWCGASGPGFWRGG
CCASFLDH
BO16371.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:22:43
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG31226-PB | 52 | CG31226-PB | 1..52 | 1..52 | 341 | 100 | Plus |
| CG31226-PA | 52 | CG31226-PA | 1..52 | 1..52 | 341 | 100 | Plus |
