Clone BO16372 Report

Search the DGRC for BO16372

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:163
Well:72
Vector:pDNR-Dual
Associated Gene/TranscriptCG31644-RA
Protein status:BO16372.pep: validated full length
Sequenced Size:295

Clone Sequence Records

BO16372.5prime Sequence

293 bp (293 high quality bases) assembled on 2006-10-13

> BO16372.5prime
GAAGTTATCAGTCGACATGCCCGAAGAAAAGTTCAAGTTTCCCATGCATG
ACTTACACTTGAAGCAAACGTTTCGCAATGTAAAAATGGCCTGCACTTTG
GCCCTGTTAGCTCCACTTCTTTTCTACACTTTACACAACAATCCGCGCAA
GAGGAAGTACAGGAACTTTTACTCCACTTACGATCCCATGGATGCGTTCG
ACCGCATGATGAGTGGAGGATACCTATCGTCCTGTCCGCCGGGCAGTGGT
CCCAAAAAGGATGACAAGAAGAAGAAAGCAAGCTTTCTAGACC

BO16372.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:06:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG31644-PA 264 CG31644-RA 1..261 17..277 1255 99.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:01:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG31644-RA 480 CG31644-RA 59..319 17..277 1275 99.2 Plus
CG31644-RC 489 CG31644-RC 81..328 30..277 1210 99.2 Plus
CG31644-RB 474 CG31644-RB 71..313 35..277 1200 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:01:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5818051..5818298 277..30 1210 99.2 Minus
Blast to na_te.dros performed on 2015-02-12 11:01:16 has no hits.

BO16372.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:49:57 Download gff for BO16372.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31644-PA 1..264 17..278 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:42:58 Download gff for BO16372.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31644-RA 53..319 12..277 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:40:45 Download gff for BO16372.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31644-RA 53..319 12..277 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:40:45 Download gff for BO16372.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 5818048..5818296 32..282 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:42:58 Download gff for BO16372.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5818048..5818296 32..282 98 <- Minus

BO16372.3prime Sequence

293 bp (293 high quality bases) assembled on 2006-10-13

> BO16372.3prime
ATGGTCTAGAAAGCTTGCTTTCTTCTTCTTGTCATCCTTTTTGGGACCAC
TGCCCGGCGGACAGGACGATAGGTATCCTCCACTCATCATGCGGTCGAAC
GCATCCATGGGATCGTAAGTGGAGTAAAAGTTCCTGTACTTCCTCTTGCG
CGGATTGTTGTGTAAAGTGTAGAAAAGAAGTGGAGCTAACAGGGCCAAAG
TGCAGGCCATTTTTACATTGCGAAACGTTTGCTTCAAGTGTAAGTCATGC
ATGGGAAACTTGAACTTTTCTTCGGGCATGTCGACTGATAACT

BO16372.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:06:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG31644-PA 264 CG31644-RA 1..261 279..19 1255 99.2 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG31644-RA 480 CG31644-RA 59..319 279..19 1275 99.2 Minus
CG31644-RC 489 CG31644-RC 81..328 266..19 1210 99.2 Minus
CG31644-RB 474 CG31644-RB 71..313 261..19 1200 99.6 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:22:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5818051..5818298 19..266 1210 99.2 Plus
Blast to na_te.dros performed on 2015-02-11 17:22:46 has no hits.

BO16372.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:49:56 Download gff for BO16372.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31644-PA 1..264 18..279 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 10:21:00 Download gff for BO16372.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31644-RA 53..319 19..284 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:08:17 Download gff for BO16372.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31644-RA 53..319 19..284 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:08:17 Download gff for BO16372.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 5818048..5818296 14..264 98 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 10:21:00 Download gff for BO16372.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5818048..5818296 14..264 98 <- Plus

BO16372.complete Sequence

295 bp assembled on 2006-10-11

GenBank Submission: FJ633799

> BO16372.complete
GAAGTTATCAGTCGACATGCCCGAAGAAAAGTTCAAGTTTCCCATGCATG
ACTTACACTTGAAGCAAACGTTTCGCAATGTAAAAATGGCCTGCACTTTG
GCCCTGTTAGCTCCACTTCTTTTCTACACTTTACACAACAATCCGCGCAA
GAGGAAGTACAGGAACTTTTACTCCACTTACGATCCCATGGATGCGTTCG
ACCGCATGATGAGTGGAGGATACCTATCGTCCTGTCCGCCGGGCAGTGGT
CCCAAAAAGGATGACAAGAAGAAGAAAGCAAGCTTTCTAGACCAT

BO16372.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG31644-RA 264 CG31644-PA 1..261 17..277 1275 99.2 Plus
CG31644-RC 273 CG31644-PC 23..270 30..277 1210 99.2 Plus
CG31644-RB 258 CG31644-PB 13..255 35..277 1200 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:40:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG31644-RA 480 CG31644-RA 59..319 17..277 1275 99.2 Plus
CG31644-RC 489 CG31644-RC 81..328 30..277 1210 99.2 Plus
CG31644-RB 474 CG31644-RB 71..313 35..277 1200 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:40:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5818051..5818298 277..30 1210 99.2 Minus
Blast to na_te.dros performed on 2014-11-27 14:40:06 has no hits.

BO16372.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:54:33 Download gff for BO16372.complete
Subject Subject Range Query Range Percent Splice Strand
CG31644-RA 1..264 17..278 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:26:48 Download gff for BO16372.complete
Subject Subject Range Query Range Percent Splice Strand
CG31644-RA 1..269 10..277 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:43:54 Download gff for BO16372.complete
Subject Subject Range Query Range Percent Splice Strand
CG31644-RA 59..319 17..279 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:54:33 Download gff for BO16372.complete
Subject Subject Range Query Range Percent Splice Strand
CG31644-RA 1..269 10..277 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:50:15 Download gff for BO16372.complete
Subject Subject Range Query Range Percent Splice Strand
CG31644-RA 59..319 17..279 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:50:15 Download gff for BO16372.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5818049..5818296 32..279 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:43:54 Download gff for BO16372.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5818049..5818296 32..279 98 <- Minus

BO16372.pep Sequence

Translation from 16 to 295

> BO16372.pep
MPEEKFKFPMHDLHLKQTFRNVKMACTLALLAPLLFYTLHNNPRKRKYRN
FYSTYDPMDAFDRMMSGGYLSSCPPGSGPKKDDKKKKASFLDH

BO16372.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:21:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG31644-PA 87 CG31644-PA 1..87 1..87 479 100 Plus
CG31644-PC 90 CG31644-PC 1..90 1..87 465 96.7 Plus
CG31644-PB 85 CG31644-PB 1..85 1..87 455 97.7 Plus