Clone Sequence Records
BO16373.3prime Sequence
272 bp (272 high quality bases) assembled on 2006-10-13
> BO16373.3prime
ATGGTCTAGAAAGCTTGCGCGACGACGATAAACATTGAAGTCCTCCGATG
CAGGACGTCCATATCGCGTTATTTTGCCCACATGATAATCTGCTGGGCCG
GGTCCCTGCGGTATCCTAGGACTATTACACGCCCTCGACGATCTGCCAAA
TGAGAACTGTGGACTTCGCTGCATCCTCTTGTCGCAGTTCTTAAACCCAA
AGGTGCTGGGCAGATTGTAGGCACCAGGGCCAGGTCCAAAAGAACGATTG
CACGACATGTCGACTGATAACT
BO16373.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:06:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31468-PA | 243 | CG31468-RA | 1..240 | 258..19 | 1200 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:56:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31468-RB | 967 | CG31468-RB | 153..393 | 259..19 | 1205 | 100 | Minus |
CG31468-RA | 447 | CG31468-RA | 153..393 | 259..19 | 1205 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:56:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 23699902..23700124 | 19..241 | 1100 | 99.6 | Plus |
Blast to na_te.dros performed on 2015-02-10 20:56:41 has no hits.
BO16373.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:49:58 Download gff for
BO16373.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31468-PA | 1..243 | 15..258 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 08:08:41 Download gff for
BO16373.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31468-RA | 153..396 | 15..259 | 99 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:33:27 Download gff for
BO16373.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31468-RA | 153..396 | 15..259 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:33:27 Download gff for
BO16373.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23699899..23700119 | 15..236 | 99 | <- | Plus |
3R | 23700180..23700202 | 237..259 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 08:08:41 Download gff for
BO16373.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 19525621..19525841 | 15..236 | 99 | <- | Plus |
arm_3R | 19525902..19525924 | 237..259 | 100 | | Plus |
BO16373.5prime Sequence
272 bp (272 high quality bases) assembled on 2006-10-13
> BO16373.5prime
GAAGTTATCAGTCGACATGTCGTGCAATCGTTCTTTTGGACCTGGCCCTG
GTGCCTACAATCTGCCCAGCACCTTTGGGTTTAAGAACTGCGACAAGAGG
ATGCAGCGAAGTCCACAGTTCTCATTTGGCAGATCGTCGAGGGCGTGTAA
TAGTCCTAGGATACCGCAGGGACCCGGCCCAGCAGATTATCATGTGGGCA
AAATAACGCGATATGGACGTCCTGCATCGGAGGACTTCAATGTTTATCGT
CGTCGCGCAAGCTTTCTAGACC
BO16373.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:06:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31468-PA | 243 | CG31468-RA | 1..240 | 17..256 | 1200 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:13:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31468-RB | 967 | CG31468-RB | 153..393 | 16..256 | 1205 | 100 | Plus |
CG31468-RA | 447 | CG31468-RA | 153..393 | 16..256 | 1205 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:13:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 23699902..23700124 | 256..34 | 1100 | 99.6 | Minus |
Blast to na_te.dros performed on 2015-02-10 17:13:26 has no hits.
BO16373.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:49:58 Download gff for
BO16373.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31468-PA | 1..243 | 17..260 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:40:04 Download gff for
BO16373.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31468-RA | 153..396 | 16..260 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:55:31 Download gff for
BO16373.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31468-RA | 153..396 | 16..260 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:55:31 Download gff for
BO16373.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23699899..23700119 | 39..260 | 99 | <- | Minus |
3R | 23700180..23700202 | 16..38 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:40:04 Download gff for
BO16373.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 19525621..19525841 | 39..260 | 99 | <- | Minus |
arm_3R | 19525902..19525924 | 16..38 | 100 | | Minus |
BO16373.complete Sequence
274 bp assembled on 2006-10-11
GenBank Submission: FJ633800
> BO16373.complete
GAAGTTATCAGTCGACATGTCGTGCAATCGTTCTTTTGGACCTGGCCCTG
GTGCCTACAATCTGCCCAGCACCTTTGGGTTTAAGAACTGCGACAAGAGG
ATGCAGCGAAGTCCACAGTTCTCATTTGGCAGATCGTCGAGGGCGTGTAA
TAGTCCTAGGATACCGCAGGGACCCGGCCCAGCAGATTATCATGTGGGCA
AAATAACGCGATATGGACGTCCTGCATCGGAGGACTTCAATGTTTATCGT
CGTCGCGCAAGCTTTCTAGACCAT
BO16373.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:04:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31468-RB | 243 | CG31468-PB | 1..240 | 17..256 | 1200 | 100 | Plus |
CG31468-RA | 243 | CG31468-PA | 1..240 | 17..256 | 1200 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:04:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31468-RB | 967 | CG31468-RB | 153..393 | 16..256 | 1205 | 100 | Plus |
CG31468-RA | 447 | CG31468-RA | 153..393 | 16..256 | 1205 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:04:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 23699902..23700124 | 256..34 | 1100 | 99.6 | Minus |
Blast to na_te.dros performed on 2014-11-28 00:04:26 has no hits.
BO16373.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:58 Download gff for
BO16373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31468-RA | 1..243 | 17..260 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:19:39 Download gff for
BO16373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31468-RA | 153..396 | 16..260 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:44:57 Download gff for
BO16373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31468-RA | 154..393 | 17..258 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:58 Download gff for
BO16373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31468-RA | 153..396 | 16..260 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:13:59 Download gff for
BO16373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31468-RA | 154..393 | 17..258 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:13:59 Download gff for
BO16373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23699900..23700119 | 39..258 | 99 | <- | Minus |
3R | 23700180..23700201 | 17..38 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:44:57 Download gff for
BO16373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 19525622..19525841 | 39..258 | 99 | <- | Minus |
arm_3R | 19525902..19525923 | 17..38 | 100 | | Minus |
BO16373.pep Sequence
Translation from 16 to 274
> BO16373.pep
MSCNRSFGPGPGAYNLPSTFGFKNCDKRMQRSPQFSFGRSSRACNSPRIP
QGPGPADYHVGKITRYGRPASEDFNVYRRRASFLDH
BO16373.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:47:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31468-PB | 80 | CG31468-PB | 1..80 | 1..80 | 446 | 100 | Plus |
CG31468-PA | 80 | CG31468-PA | 1..80 | 1..80 | 446 | 100 | Plus |
CG10252-PA | 229 | CG10252-PA | 4..75 | 5..79 | 176 | 49.3 | Plus |
CG31870-PD | 79 | CG31870-PD | 2..69 | 4..81 | 168 | 47.4 | Plus |
CG31870-PA | 79 | CG31870-PA | 2..69 | 4..81 | 168 | 47.4 | Plus |