Clone BO16373 Report

Search the DGRC for BO16373

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:163
Well:73
Vector:pDNR-Dual
Associated Gene/TranscriptCG31468-RA
Protein status:BO16373.pep: validated full length
Sequenced Size:274

Clone Sequence Records

BO16373.3prime Sequence

272 bp (272 high quality bases) assembled on 2006-10-13

> BO16373.3prime
ATGGTCTAGAAAGCTTGCGCGACGACGATAAACATTGAAGTCCTCCGATG
CAGGACGTCCATATCGCGTTATTTTGCCCACATGATAATCTGCTGGGCCG
GGTCCCTGCGGTATCCTAGGACTATTACACGCCCTCGACGATCTGCCAAA
TGAGAACTGTGGACTTCGCTGCATCCTCTTGTCGCAGTTCTTAAACCCAA
AGGTGCTGGGCAGATTGTAGGCACCAGGGCCAGGTCCAAAAGAACGATTG
CACGACATGTCGACTGATAACT

BO16373.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:06:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG31468-PA 243 CG31468-RA 1..240 258..19 1200 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:56:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG31468-RB 967 CG31468-RB 153..393 259..19 1205 100 Minus
CG31468-RA 447 CG31468-RA 153..393 259..19 1205 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:56:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23699902..23700124 19..241 1100 99.6 Plus
Blast to na_te.dros performed on 2015-02-10 20:56:41 has no hits.

BO16373.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:49:58 Download gff for BO16373.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31468-PA 1..243 15..258 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 08:08:41 Download gff for BO16373.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 153..396 15..259 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:33:27 Download gff for BO16373.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 153..396 15..259 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:33:27 Download gff for BO16373.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 23699899..23700119 15..236 99 <- Plus
3R 23700180..23700202 237..259 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 08:08:41 Download gff for BO16373.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19525621..19525841 15..236 99 <- Plus
arm_3R 19525902..19525924 237..259 100   Plus

BO16373.5prime Sequence

272 bp (272 high quality bases) assembled on 2006-10-13

> BO16373.5prime
GAAGTTATCAGTCGACATGTCGTGCAATCGTTCTTTTGGACCTGGCCCTG
GTGCCTACAATCTGCCCAGCACCTTTGGGTTTAAGAACTGCGACAAGAGG
ATGCAGCGAAGTCCACAGTTCTCATTTGGCAGATCGTCGAGGGCGTGTAA
TAGTCCTAGGATACCGCAGGGACCCGGCCCAGCAGATTATCATGTGGGCA
AAATAACGCGATATGGACGTCCTGCATCGGAGGACTTCAATGTTTATCGT
CGTCGCGCAAGCTTTCTAGACC

BO16373.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:06:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG31468-PA 243 CG31468-RA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:13:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG31468-RB 967 CG31468-RB 153..393 16..256 1205 100 Plus
CG31468-RA 447 CG31468-RA 153..393 16..256 1205 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:13:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23699902..23700124 256..34 1100 99.6 Minus
Blast to na_te.dros performed on 2015-02-10 17:13:26 has no hits.

BO16373.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:49:58 Download gff for BO16373.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31468-PA 1..243 17..260 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:40:04 Download gff for BO16373.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 153..396 16..260 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:55:31 Download gff for BO16373.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 153..396 16..260 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:55:31 Download gff for BO16373.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 23699899..23700119 39..260 99 <- Minus
3R 23700180..23700202 16..38 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:40:04 Download gff for BO16373.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19525621..19525841 39..260 99 <- Minus
arm_3R 19525902..19525924 16..38 100   Minus

BO16373.complete Sequence

274 bp assembled on 2006-10-11

GenBank Submission: FJ633800

> BO16373.complete
GAAGTTATCAGTCGACATGTCGTGCAATCGTTCTTTTGGACCTGGCCCTG
GTGCCTACAATCTGCCCAGCACCTTTGGGTTTAAGAACTGCGACAAGAGG
ATGCAGCGAAGTCCACAGTTCTCATTTGGCAGATCGTCGAGGGCGTGTAA
TAGTCCTAGGATACCGCAGGGACCCGGCCCAGCAGATTATCATGTGGGCA
AAATAACGCGATATGGACGTCCTGCATCGGAGGACTTCAATGTTTATCGT
CGTCGCGCAAGCTTTCTAGACCAT

BO16373.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG31468-RB 243 CG31468-PB 1..240 17..256 1200 100 Plus
CG31468-RA 243 CG31468-PA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG31468-RB 967 CG31468-RB 153..393 16..256 1205 100 Plus
CG31468-RA 447 CG31468-RA 153..393 16..256 1205 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23699902..23700124 256..34 1100 99.6 Minus
Blast to na_te.dros performed on 2014-11-28 00:04:26 has no hits.

BO16373.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:58 Download gff for BO16373.complete
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 1..243 17..260 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:19:39 Download gff for BO16373.complete
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 153..396 16..260 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:44:57 Download gff for BO16373.complete
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 154..393 17..258 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:58 Download gff for BO16373.complete
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 153..396 16..260 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:13:59 Download gff for BO16373.complete
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 154..393 17..258 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:13:59 Download gff for BO16373.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23699900..23700119 39..258 99 <- Minus
3R 23700180..23700201 17..38 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:44:57 Download gff for BO16373.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19525622..19525841 39..258 99 <- Minus
arm_3R 19525902..19525923 17..38 100   Minus

BO16373.pep Sequence

Translation from 16 to 274

> BO16373.pep
MSCNRSFGPGPGAYNLPSTFGFKNCDKRMQRSPQFSFGRSSRACNSPRIP
QGPGPADYHVGKITRYGRPASEDFNVYRRRASFLDH

BO16373.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:47:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG31468-PB 80 CG31468-PB 1..80 1..80 446 100 Plus
CG31468-PA 80 CG31468-PA 1..80 1..80 446 100 Plus
CG10252-PA 229 CG10252-PA 4..75 5..79 176 49.3 Plus
CG31870-PD 79 CG31870-PD 2..69 4..81 168 47.4 Plus
CG31870-PA 79 CG31870-PA 2..69 4..81 168 47.4 Plus