Clone Sequence Records
BO16375.3prime Sequence
281 bp (281 high quality bases) assembled on 2006-10-13
> BO16375.3prime
ATGGTCTAGAAAGCTTGCTTTCTCGGGGCGACAGGGTCCATCTTTGCAAG
GATCCCGACATCGTTTGCTCTTCTCCTTCTTGTTCTCCCTCCTAAATGGT
TCGGACTTCTTAAAGCAGCCGCCAAAGAACTGATTCTTATTACAGGTTTT
CTTGCCCTTTTCGGTGCCTTGACTTTGGCTCTTCTTTTTGGCCATTCCTC
TGCAAAAGTATAGTGATTGATGAAGCAACTCGTTTTTGGGCAGAAATTTT
AACAGAATTCCACTCATGTCGACTGATAACT
BO16375.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:58:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32148-PA | 252 | CG32148-RA | 1..249 | 267..19 | 1220 | 99.5 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 12:27:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32148-RA | 456 | CG32148-RA | 75..323 | 267..19 | 1230 | 99.6 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 12:27:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 15023566..15023725 | 267..108 | 800 | 100 | Minus |
3L | 28110227 | 3L | 15023788..15023876 | 107..19 | 430 | 98.9 | Minus |
Blast to na_te.dros performed on 2015-02-12 12:27:39 has no hits.
BO16375.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:50:01 Download gff for
BO16375.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32148-PA | 1..252 | 18..267 | 98 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:29:27 Download gff for
BO16375.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32148-RA | 67..323 | 19..276 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 14:15:24 Download gff for
BO16375.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32148-RA | 67..323 | 19..276 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 14:15:24 Download gff for
BO16375.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15023788..15023876 | 19..107 | 98 | | Minus |
3L | 15023558..15023725 | 108..276 | 97 | -> | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:29:27 Download gff for
BO16375.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 15016658..15016825 | 108..276 | 97 | -> | Minus |
arm_3L | 15016888..15016976 | 19..107 | 98 | | Minus |
BO16375.5prime Sequence
281 bp (281 high quality bases) assembled on 2006-10-13
> BO16375.5prime
GAAGTTATCAGTCGACATGAGTGGAATTCTGTTAAAATTTCTGCCCAAAA
ACGAGTTGCTTCATCAATCACTATACTTTTGCAGAGGAATGGCCAAAAAG
AAGAGCCAAAGTCAAGGCACCGAAAAGGGCAAGAAAACCTGTAATAAGAA
TCAGTTCTTTGGCGGCTGCTTTAAGAAGTCCGAACCATTTAGGAGGGAGA
ACAAGAAGGAGAAGAGCAAACGATGTCGGGATCCTTGCAAAGATGGACCC
TGTCGCCCCGAGAAAGCAAGCTTTCTAGACC
BO16375.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:58:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32148-PA | 252 | CG32148-RA | 1..249 | 17..265 | 1220 | 99.5 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:32:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32148-RA | 456 | CG32148-RA | 75..323 | 17..265 | 1230 | 99.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:32:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 15023566..15023725 | 17..176 | 800 | 100 | Plus |
3L | 28110227 | 3L | 15023788..15023876 | 177..265 | 430 | 98.9 | Plus |
Blast to na_te.dros performed on 2015-02-12 10:32:43 has no hits.
BO16375.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:50:02 Download gff for
BO16375.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32148-PA | 1..252 | 17..266 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 23:34:36 Download gff for
BO16375.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32148-RA | 67..323 | 8..265 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:02:51 Download gff for
BO16375.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32148-RA | 67..323 | 8..265 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:02:51 Download gff for
BO16375.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15023558..15023725 | 8..176 | 97 | -> | Plus |
3L | 15023788..15023876 | 177..265 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 23:34:36 Download gff for
BO16375.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 15016658..15016825 | 8..176 | 97 | -> | Plus |
arm_3L | 15016888..15016976 | 177..265 | 98 | | Plus |
BO16375.complete Sequence
283 bp assembled on 2007-10-17
GenBank Submission: FJ633801
> BO16375.complete
GAAGTTATCAGTCGACATGAGTGGAATTCTGTTAAAATTTCTGCCCAAAA
ACGAGTTGCTTCATCAATCACTATACTTTTGCAGAGGAATGGCCAAAAAG
AAGAGCCAAAGTCAAGGCACCGAAAAGGGCAAGAAAACCTGTAATAAGAA
TCAGTTCTTTGGCGGCTGCTTTAAGAAGTCCGAACCATTTAGGAGGGAGA
ACAAGAAGGAGAAGAGCAAACGATGTCGGGATCCTTGCAAAGATGGACCC
TGTCGCCCCGAGAAAGCAAGCTTTCTAGACCAT
BO16375.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:06:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32148-RA | 252 | CG32148-PA | 1..249 | 17..265 | 1230 | 99.6 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:06:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32148-RA | 456 | CG32148-RA | 75..323 | 17..265 | 1230 | 99.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:05:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 15023566..15023725 | 17..176 | 800 | 100 | Plus |
3L | 28110227 | 3L | 15023788..15023876 | 177..265 | 430 | 98.9 | Plus |
Blast to na_te.dros performed on 2014-11-28 00:05:59 has no hits.
BO16375.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:03:06 Download gff for
BO16375.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32148-RA | 1..252 | 17..266 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:16:42 Download gff for
BO16375.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32148-RA | 67..323 | 8..265 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:45:30 Download gff for
BO16375.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32148-RA | 75..323 | 17..267 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:35:25 Download gff for
BO16375.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32148-RA | 75..323 | 17..267 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:14:26 Download gff for
BO16375.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32148-RA | 75..323 | 17..267 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:14:26 Download gff for
BO16375.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15023566..15023725 | 17..176 | 100 | -> | Plus |
3L | 15023788..15023876 | 177..267 | 96 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:45:30 Download gff for
BO16375.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 15016666..15016825 | 17..176 | 100 | -> | Plus |
arm_3L | 15016888..15016976 | 177..267 | 96 | | Plus |
BO16375.pep Sequence
Translation from 16 to 283
> BO16375.pep
MSGILLKFLPKNELLHQSLYFCRGMAKKKSQSQGTEKGKKTCNKNQFFGG
CFKKSEPFRRENKKEKSKRCRDPCKDGPCRPEKASFLDH
BO16375.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:28:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32148-PA | 83 | CG32148-PA | 1..83 | 1..83 | 459 | 100 | Plus |