Clone BO16379 Report

Search the DGRC for BO16379

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:163
Well:79
Vector:pDNR-Dual
Associated Gene/TranscriptCG31740-RA
Protein status:BO16379.pep: validated full length
Sequenced Size:217

Clone Sequence Records

BO16379.5prime Sequence

215 bp (215 high quality bases) assembled on 2006-10-13

> BO16379.5prime
GAAGTTATCAGTCGACATGGTTCTGATGCTTTGCTGCAGCTTCGATCCCT
TCTACGTTGGACCCTGCCCACCCGGCTGCCTGGCTCCTTTGATGGGAGGA
ACTCCCTATTGCGGATGTGGTCCCTGTGGAGGTTGCTGTAGTCCTTGCTG
TGGTCCATGTGGTCCTTGTGGTGGCTGCAGCTCGTGTCCTTGCGGCTGGG
CAAGCTTTCTAGACC

BO16379.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:07:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG31740-PA 186 CG31740-RA 1..183 17..199 915 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:23:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG31740-RA 606 CG31740-RA 220..402 17..199 915 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18009308..18009490 17..199 915 100 Plus
Blast to na_te.dros performed on 2015-02-11 17:23:31 has no hits.

BO16379.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:50:07 Download gff for BO16379.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31740-PA 1..186 17..202 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 10:21:08 Download gff for BO16379.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 215..408 12..205 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:10:38 Download gff for BO16379.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 215..408 12..205 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:10:38 Download gff for BO16379.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 18009303..18009496 12..204 97 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 10:21:08 Download gff for BO16379.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18009303..18009496 12..204 97 -> Plus

BO16379.3prime Sequence

215 bp (215 high quality bases) assembled on 2006-10-13

> BO16379.3prime
ATGGTCTAGAAAGCTTGCCCAGCCGCAAGGACACGAGCTGCAGCCACCAC
AAGGACCACATGGACCACAGCAAGGACTACAGCAACCTCCACAGGGACCA
CATCCGCAATAGGGAGTTCCTCCCATCAAAGGAGCCAGGCAGCCGGGTGG
GCAGGGTCCAACGTAGAAGGGATCGAAGCTGCAGCAAAGCATCAGAACCA
TGTCGACTGATAACT

BO16379.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:07:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG31740-PA 186 CG31740-RA 1..183 201..19 915 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG31740-RA 606 CG31740-RA 220..402 201..19 915 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 09:05:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18009308..18009490 201..19 915 100 Minus
Blast to na_te.dros performed on 2015-02-11 09:06:00 has no hits.

BO16379.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:50:06 Download gff for BO16379.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31740-PA 1..186 16..201 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 16:59:40 Download gff for BO16379.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 215..408 13..206 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:49:38 Download gff for BO16379.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 215..408 13..206 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 10:49:38 Download gff for BO16379.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 18009303..18009496 14..206 97 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 16:59:40 Download gff for BO16379.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18009303..18009496 14..206 97 -> Minus

BO16379.complete Sequence

217 bp assembled on 2006-10-11

GenBank Submission: FJ633804

> BO16379.complete
GAAGTTATCAGTCGACATGGTTCTGATGCTTTGCTGCAGCTTCGATCCCT
TCTACGTTGGACCCTGCCCACCCGGCTGCCTGGCTCCTTTGATGGGAGGA
ACTCCCTATTGCGGATGTGGTCCCTGTGGAGGTTGCTGTAGTCCTTGCTG
TGGTCCATGTGGTCCTTGTGGTGGCTGCAGCTCGTGTCCTTGCGGCTGGG
CAAGCTTTCTAGACCAT

BO16379.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG31740-RA 186 CG31740-PA 1..183 17..199 915 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:22:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG31740-RA 606 CG31740-RA 220..402 17..199 915 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:22:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18009308..18009490 17..199 915 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:22:27 has no hits.

BO16379.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:36 Download gff for BO16379.complete
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 1..186 17..202 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:11:38 Download gff for BO16379.complete
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 240..433 12..205 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:50:59 Download gff for BO16379.complete
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 220..402 17..201 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:37 Download gff for BO16379.complete
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 240..433 12..205 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:19:19 Download gff for BO16379.complete
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 220..402 17..201 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:19:19 Download gff for BO16379.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18009308..18009490 17..201 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:50:59 Download gff for BO16379.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18009308..18009490 17..201 98   Plus

BO16379.pep Sequence

Translation from 16 to 217

> BO16379.pep
MVLMLCCSFDPFYVGPCPPGCLAPLMGGTPYCGCGPCGGCCSPCCGPCGP
CGGCSSCPCGWASFLDH

BO16379.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG31740-PA 61 CG31740-PA 1..61 1..61 406 100 Plus
Mst87F-PB 56 CG17956-PB 1..53 5..61 152 49.2 Plus
Mst87F-PA 56 CG17956-PA 1..53 5..61 152 49.2 Plus
Mst84Db-PA 74 CG17934-PA 1..59 5..60 150 49.2 Plus
Mst84Dd-PA 72 CG17935-PA 14..56 15..54 149 60 Plus
Mst84Db-PA 74 CG17934-PA 23..68 15..59 132 53.1 Plus