Clone Sequence Records
BO16379.5prime Sequence
215 bp (215 high quality bases) assembled on 2006-10-13
> BO16379.5prime
GAAGTTATCAGTCGACATGGTTCTGATGCTTTGCTGCAGCTTCGATCCCT
TCTACGTTGGACCCTGCCCACCCGGCTGCCTGGCTCCTTTGATGGGAGGA
ACTCCCTATTGCGGATGTGGTCCCTGTGGAGGTTGCTGTAGTCCTTGCTG
TGGTCCATGTGGTCCTTGTGGTGGCTGCAGCTCGTGTCCTTGCGGCTGGG
CAAGCTTTCTAGACC
BO16379.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:07:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31740-PA | 186 | CG31740-RA | 1..183 | 17..199 | 915 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:23:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31740-RA | 606 | CG31740-RA | 220..402 | 17..199 | 915 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:23:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 18009308..18009490 | 17..199 | 915 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-11 17:23:31 has no hits.
BO16379.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:50:07 Download gff for
BO16379.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-PA | 1..186 | 17..202 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 10:21:08 Download gff for
BO16379.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 215..408 | 12..205 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:10:38 Download gff for
BO16379.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 215..408 | 12..205 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:10:38 Download gff for
BO16379.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18009303..18009496 | 12..204 | 97 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 10:21:08 Download gff for
BO16379.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 18009303..18009496 | 12..204 | 97 | -> | Plus |
BO16379.3prime Sequence
215 bp (215 high quality bases) assembled on 2006-10-13
> BO16379.3prime
ATGGTCTAGAAAGCTTGCCCAGCCGCAAGGACACGAGCTGCAGCCACCAC
AAGGACCACATGGACCACAGCAAGGACTACAGCAACCTCCACAGGGACCA
CATCCGCAATAGGGAGTTCCTCCCATCAAAGGAGCCAGGCAGCCGGGTGG
GCAGGGTCCAACGTAGAAGGGATCGAAGCTGCAGCAAAGCATCAGAACCA
TGTCGACTGATAACT
BO16379.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:07:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31740-PA | 186 | CG31740-RA | 1..183 | 201..19 | 915 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:06:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31740-RA | 606 | CG31740-RA | 220..402 | 201..19 | 915 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 09:05:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 18009308..18009490 | 201..19 | 915 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-11 09:06:00 has no hits.
BO16379.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:50:06 Download gff for
BO16379.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-PA | 1..186 | 16..201 | 98 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 16:59:40 Download gff for
BO16379.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 215..408 | 13..206 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:49:38 Download gff for
BO16379.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 215..408 | 13..206 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 10:49:38 Download gff for
BO16379.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18009303..18009496 | 14..206 | 97 | -> | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 16:59:40 Download gff for
BO16379.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 18009303..18009496 | 14..206 | 97 | -> | Minus |
BO16379.complete Sequence
217 bp assembled on 2006-10-11
GenBank Submission: FJ633804
> BO16379.complete
GAAGTTATCAGTCGACATGGTTCTGATGCTTTGCTGCAGCTTCGATCCCT
TCTACGTTGGACCCTGCCCACCCGGCTGCCTGGCTCCTTTGATGGGAGGA
ACTCCCTATTGCGGATGTGGTCCCTGTGGAGGTTGCTGTAGTCCTTGCTG
TGGTCCATGTGGTCCTTGTGGTGGCTGCAGCTCGTGTCCTTGCGGCTGGG
CAAGCTTTCTAGACCAT
BO16379.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:22:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31740-RA | 186 | CG31740-PA | 1..183 | 17..199 | 915 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:22:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31740-RA | 606 | CG31740-RA | 220..402 | 17..199 | 915 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:22:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 18009308..18009490 | 17..199 | 915 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 00:22:27 has no hits.
BO16379.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:36 Download gff for
BO16379.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 1..186 | 17..202 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:11:38 Download gff for
BO16379.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 240..433 | 12..205 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:50:59 Download gff for
BO16379.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 220..402 | 17..201 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:37 Download gff for
BO16379.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 240..433 | 12..205 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:19:19 Download gff for
BO16379.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 220..402 | 17..201 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:19:19 Download gff for
BO16379.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18009308..18009490 | 17..201 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:50:59 Download gff for
BO16379.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 18009308..18009490 | 17..201 | 98 | | Plus |
BO16379.pep Sequence
Translation from 16 to 217
> BO16379.pep
MVLMLCCSFDPFYVGPCPPGCLAPLMGGTPYCGCGPCGGCCSPCCGPCGP
CGGCSSCPCGWASFLDH
BO16379.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:22:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31740-PA | 61 | CG31740-PA | 1..61 | 1..61 | 406 | 100 | Plus |
Mst87F-PB | 56 | CG17956-PB | 1..53 | 5..61 | 152 | 49.2 | Plus |
Mst87F-PA | 56 | CG17956-PA | 1..53 | 5..61 | 152 | 49.2 | Plus |
Mst84Db-PA | 74 | CG17934-PA | 1..59 | 5..60 | 150 | 49.2 | Plus |
Mst84Dd-PA | 72 | CG17935-PA | 14..56 | 15..54 | 149 | 60 | Plus |
Mst84Db-PA | 74 | CG17934-PA | 23..68 | 15..59 | 132 | 53.1 | Plus |