Clone BO16406 Report

Search the DGRC for BO16406

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:164
Well:6
Vector:pDNR-Dual
Associated Gene/TranscriptCG32711-RA
Protein status:BO16406.pep: validated full length
Sequenced Size:253

Clone Sequence Records

BO16406.3prime Sequence

251 bp (251 high quality bases) assembled on 2006-10-13

> BO16406.3prime
ATGGTCTAGAAAGCTTGCTAGAAACGTTAAGCAGCGGCAGTAGCAGCAAC
AAGAACAACAGCAGCAACAACAACTACTACAACGAACAGAGACGACGTCG
AAGGAAAGATTTTTACTCGCGTCGCGGTATACTTCAACTGTTTTTGAACT
TTTATTGCGTGTTTGCTGCTGCGACAAAACTTGCGCGGCGCCACAAAGCG
GAGAAAACGTTGACCGCGTGTGTGTGGCGGAGAGCATGTCGACTGATAAC
T

BO16406.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:07:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG32711-PA 222 CG32711-RA 1..219 237..19 1095 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:19:41
Subject Length Description Subject Range Query Range Score Percent Strand
lawc-RA 1072 CG32711-RA 124..343 238..19 1100 100 Minus
lawc-RB 1332 CG32711-RB 124..343 238..19 1100 100 Minus
lawc-RD 1870 CG32711-RD 124..343 238..19 1100 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:19:33
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8409756..8409975 19..238 1100 100 Plus
Blast to na_te.dros performed on 2015-02-10 17:19:37 has no hits.

BO16406.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:50:39 Download gff for BO16406.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32711-PA 1..222 18..237 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:40:31 Download gff for BO16406.3prime
Subject Subject Range Query Range Percent Splice Strand
lawc-RD 120..343 19..244 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:56:27 Download gff for BO16406.3prime
Subject Subject Range Query Range Percent Splice Strand
lawc-RD 120..343 19..244 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:56:27 Download gff for BO16406.3prime
Subject Subject Range Query Range Percent Splice Strand
X 8409756..8409979 19..244 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:40:31 Download gff for BO16406.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 8303789..8304012 19..244 99   Plus

BO16406.5prime Sequence

251 bp (251 high quality bases) assembled on 2006-10-13

> BO16406.5prime
GAAGTTATCAGTCGACATGCTCTCCGCCACACACACGCGGTCAACGTTTT
CTCCGCTTTGTGGCGCCGCGCAAGTTTTGTCGCAGCAGCAAACACGCAAT
AAAAGTTCAAAAACAGTTGAAGTATACCGCGACGCGAGTAAAAATCTTTC
CTTCGACGTCGTCTCTGTTCGTTGTAGTAGTTGTTGTTGCTGCTGTTGTT
CTTGTTGCTGCTACTGCCGCTGCTTAACGTTTCTAGCAAGCTTTCTAGAC
C

BO16406.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:07:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG32711-PA 222 CG32711-RA 1..219 17..235 1095 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
lawc-RA 1072 CG32711-RA 124..343 16..235 1100 100 Plus
lawc-RB 1332 CG32711-RB 124..343 16..235 1100 100 Plus
lawc-RD 1870 CG32711-RD 124..343 16..235 1100 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:05:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8409756..8409975 235..16 1100 100 Minus
Blast to na_te.dros performed on 2015-02-10 21:05:33 has no hits.

BO16406.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:50:40 Download gff for BO16406.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32711-PA 1..222 17..236 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 08:09:52 Download gff for BO16406.5prime
Subject Subject Range Query Range Percent Splice Strand
lawc-RD 120..343 10..235 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:31:44 Download gff for BO16406.5prime
Subject Subject Range Query Range Percent Splice Strand
lawc-RD 120..343 10..235 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:31:44 Download gff for BO16406.5prime
Subject Subject Range Query Range Percent Splice Strand
X 8409756..8409979 10..235 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 08:09:52 Download gff for BO16406.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 8303789..8304012 10..235 99   Minus

BO16406.complete Sequence

253 bp assembled on 2006-10-11

GenBank Submission: FJ633816

> BO16406.complete
GAAGTTATCAGTCGACATGCTCTCCGCCACACACACGCGGTCAACGTTTT
CTCCGCTTTGTGGCGCCGCGCAAGTTTTGTCGCAGCAGCAAACACGCAAT
AAAAGTTCAAAAACAGTTGAAGTATACCGCGACGCGAGTAAAAATCTTTC
CTTCGACGTCGTCTCTGTTCGTTGTAGTAGTTGTTGTTGCTGCTGTTGTT
CTTGTTGCTGCTACTGCCGCTGCTTAACGTTTCTAGCAAGCTTTCTAGAC
CAT

BO16406.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:05:54
Subject Length Description Subject Range Query Range Score Percent Strand
lawc-RA 222 CG32711-PA 1..219 17..235 1095 100 Plus
lawc-RB 222 CG32711-PB 1..219 17..235 1095 100 Plus
lawc-RD 222 CG32711-PD 1..219 17..235 1095 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:05:56
Subject Length Description Subject Range Query Range Score Percent Strand
lawc-RA 1072 CG32711-RA 124..343 16..235 1100 100 Plus
lawc-RB 1332 CG32711-RB 124..343 16..235 1100 100 Plus
lawc-RD 1870 CG32711-RD 124..343 16..235 1100 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8409756..8409975 235..16 1100 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:05:53 has no hits.

BO16406.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:58:09 Download gff for BO16406.complete
Subject Subject Range Query Range Percent Splice Strand
CG32711-RA 1..222 17..236 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:30:25 Download gff for BO16406.complete
Subject Subject Range Query Range Percent Splice Strand
CG32711-RA 117..340 10..235 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:52:15 Download gff for BO16406.complete
Subject Subject Range Query Range Percent Splice Strand
lawc-RD 125..343 17..237 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed on 2008-07-21 22:58:09 has no hits.
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:11:10 Download gff for BO16406.complete
Subject Subject Range Query Range Percent Splice Strand
lawc-RD 125..343 17..237 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:11:10 Download gff for BO16406.complete
Subject Subject Range Query Range Percent Splice Strand
X 8409754..8409974 17..237 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:52:15 Download gff for BO16406.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8303787..8304007 17..237 99   Minus

BO16406.pep Sequence

Translation from 16 to 253

> BO16406.pep
MLSATHTRSTFSPLCGAAQVLSQQQTRNKSSKTVEVYRDASKNLSFDVVS
VRCSSCCCCCCSCCCYCRCLTFLASFLDH

BO16406.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:20:19
Subject Length Description Subject Range Query Range Score Percent Strand
lawc-PA 73 CG32711-PA 1..73 1..73 406 100 Plus
lawc-PB 73 CG32711-PB 1..73 1..73 406 100 Plus
lawc-PD 73 CG32711-PD 1..73 1..73 406 100 Plus
lawc-PC 73 CG32711-PC 1..73 1..73 406 100 Plus