Clone BO16641 Report

Search the DGRC for BO16641

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:166
Well:41
Vector:pDNR-Dual
Associated Gene/TranscriptDef-RA
Protein status:BO16641.pep: validated full length
Sequenced Size:310

Clone Sequence Records

BO16641.3prime Sequence

308 bp (308 high quality bases) assembled on 2006-10-13

> BO16641.3prime
ATGGTCTAGAAAGCTTGCATTGCGGCAAACGCAGACGGCCTTGTCGTTGC
AGTAGCCGCCTTTGAACCCCTTGGCAATGCAGTGGCCGGCGCAGGCGGTG
TGGTTCCAGTTCCACTTGGAGAGTAGGTCGCATGTGGCTCGCTTCTGGCG
GCTATGCTGCAGCACCTCCTGGTGGGCATCCTCATGCACCAGGACATGAT
CCTCTGGAATTGGATCCACATCGGAAACTGGCTGAGCCTGCGCCACGCAA
GCAAGCAGAGCAAAAGCGATAGCCACGAGAACGAAGAACTTCATGTCGAC
TGATAACT

BO16641.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:08:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG1385-PA 279 Def-RA 1..276 294..19 1380 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 11:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
Def-RA 399 CG1385-RA 10..285 294..19 1380 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 11:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10054292..10054567 19..294 1380 100 Plus
Blast to na_te.dros performed on 2015-02-08 11:44:21 has no hits.

BO16641.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:54:21 Download gff for BO16641.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1385-PA 1..279 16..294 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:36:31 Download gff for BO16641.3prime
Subject Subject Range Query Range Percent Splice Strand
Def-RA 10..285 19..294 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 13:41:52 Download gff for BO16641.3prime
Subject Subject Range Query Range Percent Splice Strand
Def-RA 10..285 19..294 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 13:41:52 Download gff for BO16641.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 10054292..10054567 19..294 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:36:31 Download gff for BO16641.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5941797..5942072 19..294 100   Plus

BO16641.5prime Sequence

308 bp (308 high quality bases) assembled on 2006-10-13

> BO16641.5prime
GAAGTTATCAGTCGACATGAAGTTCTTCGTTCTCGTGGCTATCGCTTTTG
CTCTGCTTGCTTGCGTGGCGCAGGCTCAGCCAGTTTCCGATGTGGATCCA
ATTCCAGAGGATCATGTCCTGGTGCATGAGGATGCCCACCAGGAGGTGCT
GCAGCATAGCCGCCAGAAGCGAGCCACATGCGACCTACTCTCCAAGTGGA
ACTGGAACCACACCGCCTGCGCCGGCCACTGCATTGCCAAGGGGTTCAAA
GGCGGCTACTGCAACGACAAGGCCGTCTGCGTTTGCCGCAATGCAAGCTT
TCTAGACC

BO16641.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:08:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG1385-PA 279 Def-RA 1..276 17..292 1380 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 17:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
Def-RA 399 CG1385-RA 10..285 17..292 1380 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 17:40:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10054292..10054567 292..17 1380 100 Minus
Blast to na_te.dros performed on 2015-02-12 17:40:24 has no hits.

BO16641.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:54:21 Download gff for BO16641.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1385-PA 1..279 17..295 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 02:40:02 Download gff for BO16641.5prime
Subject Subject Range Query Range Percent Splice Strand
Def-RA 10..285 17..292 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 19:47:29 Download gff for BO16641.5prime
Subject Subject Range Query Range Percent Splice Strand
Def-RA 10..285 17..292 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 19:47:29 Download gff for BO16641.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 10054292..10054567 17..292 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 02:40:02 Download gff for BO16641.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5941797..5942072 17..292 100   Minus

BO16641.complete Sequence

310 bp assembled on 2006-10-11

GenBank Submission: FJ633872

> BO16641.complete
GAAGTTATCAGTCGACATGAAGTTCTTCGTTCTCGTGGCTATCGCTTTTG
CTCTGCTTGCTTGCGTGGCGCAGGCTCAGCCAGTTTCCGATGTGGATCCA
ATTCCAGAGGATCATGTCCTGGTGCATGAGGATGCCCACCAGGAGGTGCT
GCAGCATAGCCGCCAGAAGCGAGCCACATGCGACCTACTCTCCAAGTGGA
ACTGGAACCACACCGCCTGCGCCGGCCACTGCATTGCCAAGGGGTTCAAA
GGCGGCTACTGCAACGACAAGGCCGTCTGCGTTTGCCGCAATGCAAGCTT
TCTAGACCAT

BO16641.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:15:35
Subject Length Description Subject Range Query Range Score Percent Strand
Def-RA 279 CG1385-PA 1..276 17..292 1380 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
Def-RA 399 CG1385-RA 10..285 17..292 1380 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10054292..10054567 292..17 1380 100 Minus
Blast to na_te.dros performed on 2014-11-26 22:15:34 has no hits.

BO16641.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:26:13 Download gff for BO16641.complete
Subject Subject Range Query Range Percent Splice Strand
Def-RA 1..279 17..295 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:46:17 Download gff for BO16641.complete
Subject Subject Range Query Range Percent Splice Strand
Def-RA 1..279 17..295 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:52:07 Download gff for BO16641.complete
Subject Subject Range Query Range Percent Splice Strand
Def-RA 10..285 17..294 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:26:14 Download gff for BO16641.complete
Subject Subject Range Query Range Percent Splice Strand
Def-RA 1..279 17..295 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:55:45 Download gff for BO16641.complete
Subject Subject Range Query Range Percent Splice Strand
Def-RA 10..285 17..294 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:55:45 Download gff for BO16641.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10054289..10054567 17..294 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:52:07 Download gff for BO16641.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5941794..5942072 17..294 99   Minus

BO16641.pep Sequence

Translation from 16 to 310

> BO16641.pep
MKFFVLVAIAFALLACVAQAQPVSDVDPIPEDHVLVHEDAHQEVLQHSRQ
KRATCDLLSKWNWNHTACAGHCIAKGFKGGYCNDKAVCVCRNASFLDH

BO16641.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:56:40
Subject Length Description Subject Range Query Range Score Percent Strand
Def-PA 92 CG1385-PA 1..92 1..92 509 100 Plus