Clone BO16676 Report

Search the DGRC for BO16676

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:166
Well:76
Vector:pDNR-Dual
Associated Gene/TranscriptCG8498-RA
Protein status:BO16676.pep: validated full length
Sequenced Size:304

Clone Sequence Records

BO16676.5prime Sequence

302 bp (302 high quality bases) assembled on 2006-10-13

> BO16676.5prime
GAAGTTATCAGTCGACATGTCCGAATTGCAGGAATTCAACCAGGCGGCCG
AAGATGTTAAGAACCTAAACACCACACCCGGGGACAATGACCTTTTGGAG
CTCTACAGCTTGTACAAACAGGCCACTGTGGGGGATTGCAATACAGATAA
GCCCGGCTTTCTGGACTTCAAGGGCAAGGCCAAGTGGGAGGCGTGGAACA
ACCGCAAGGGAATGAGCAATACCGACGCCCAGGCCGCCTACATTACCAAG
GTCAAGGCACTGATCGCTGCCGTTGGCCTGAAGTCAGCAAGCTTTCTAGA
CC

BO16676.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG8498-PA 273 CG8498-RA 1..270 17..286 1350 100 Plus
CG8627-PB 261 Dbi-RB 151..182 170..201 135 96.8 Plus
CG8627-PA 261 Dbi-RA 151..182 170..201 135 96.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 17:42:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG8498-RB 525 CG8498-RB 128..397 17..286 1350 100 Plus
CG8498-RA 491 CG8498-RA 94..363 17..286 1350 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 17:42:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8161924..8162071 286..139 725 99.3 Minus
2L 23513712 2L 8162123..8162240 146..29 590 100 Minus
Blast to na_te.dros performed on 2015-02-12 17:42:28 has no hits.

BO16676.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:55:03 Download gff for BO16676.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8498-PA 1..273 17..287 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 02:40:38 Download gff for BO16676.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 94..363 17..286 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 19:53:56 Download gff for BO16676.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 94..363 17..286 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 19:53:56 Download gff for BO16676.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 8161924..8162063 147..286 100 <- Minus
2L 8162123..8162237 32..146 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 02:40:38 Download gff for BO16676.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8161924..8162063 147..286 100 <- Minus
arm_2L 8162123..8162237 32..146 100 <- Minus

BO16676.3prime Sequence

302 bp (302 high quality bases) assembled on 2006-10-13

> BO16676.3prime
ATGGTCTAGAAAGCTTGCTGACTTCAGGCCAACGGCAGCGATCAGTGCCT
TGACCTTGGTAATGTAGGCGGCCTGGGCGTCGGTATTGCTCATTCCCTTG
CGGTTGTTCCACGCCTCCCACTTGGCCTTGCCCTTGAAGTCCAGAAAGCC
GGGCTTATCTGTATTGCAATCCCCCACAGTGGCCTGTTTGTACAAGCTGT
AGAGCTCCAAAAGGTCATTGTCCCCGGGTGTGGTGTTTAGGTTCTTAACA
TCTTCGGCCGCCTGGTTGAATTCCTGCAATTCGGACATGTCGACTGATAA
CT

BO16676.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG8498-PA 273 CG8498-RA 1..270 288..19 1350 100 Minus
CG8627-PB 261 Dbi-RB 151..182 135..104 135 96.8 Minus
CG8627-PA 261 Dbi-RA 151..182 135..104 135 96.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG8498-RB 525 CG8498-RB 128..397 288..19 1350 100 Minus
CG8498-RA 491 CG8498-RA 94..363 288..19 1350 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:34:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8161924..8162071 19..166 725 99.3 Plus
2L 23513712 2L 8162123..8162240 159..276 590 100 Plus
Blast to na_te.dros performed on 2015-02-10 16:34:42 has no hits.

BO16676.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:55:02 Download gff for BO16676.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8498-PA 1..273 18..288 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 20:17:55 Download gff for BO16676.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 94..363 19..288 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:03:05 Download gff for BO16676.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 94..363 19..288 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:03:05 Download gff for BO16676.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 8161924..8162063 19..158 100 <- Plus
2L 8162123..8162237 159..273 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 20:17:55 Download gff for BO16676.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8161924..8162063 19..158 100 <- Plus
arm_2L 8162123..8162237 159..273 100 <- Plus

BO16676.complete Sequence

304 bp assembled on 2006-10-11

GenBank Submission: FJ633885

> BO16676.complete
GAAGTTATCAGTCGACATGTCCGAATTGCAGGAATTCAACCAGGCGGCCG
AAGATGTTAAGAACCTAAACACCACACCCGGGGACAATGACCTTTTGGAG
CTCTACAGCTTGTACAAACAGGCCACTGTGGGGGATTGCAATACAGATAA
GCCCGGCTTTCTGGACTTCAAGGGCAAGGCCAAGTGGGAGGCGTGGAACA
ACCGCAAGGGAATGAGCAATACCGACGCCCAGGCCGCCTACATTACCAAG
GTCAAGGCACTGATCGCTGCCGTTGGCCTGAAGTCAGCAAGCTTTCTAGA
CCAT

BO16676.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:49:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG8498-RB 273 CG8498-PB 1..270 17..286 1350 100 Plus
CG8498-RA 273 CG8498-PA 1..270 17..286 1350 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:49:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG8498-RB 525 CG8498-RB 128..397 17..286 1350 100 Plus
CG8498-RA 491 CG8498-RA 94..363 17..286 1350 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:49:30
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8161924..8162071 286..139 725 99.3 Minus
2L 23513712 2L 8162123..8162240 146..29 590 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:49:31 has no hits.

BO16676.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:05:08 Download gff for BO16676.complete
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 1..273 17..287 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:19:52 Download gff for BO16676.complete
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 65..334 17..286 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:25:55 Download gff for BO16676.complete
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 94..363 17..288 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:05:08 Download gff for BO16676.complete
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 65..334 17..286 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:56:47 Download gff for BO16676.complete
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 94..363 17..288 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:56:47 Download gff for BO16676.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8161922..8162063 147..288 98 <- Minus
2L 8162123..8162237 32..146 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:25:55 Download gff for BO16676.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8161922..8162063 147..288 98 <- Minus
arm_2L 8162123..8162237 32..146 100 <- Minus

BO16676.pep Sequence

Translation from 16 to 304

> BO16676.pep
MSELQEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLD
FKGKAKWEAWNNRKGMSNTDAQAAYITKVKALIAAVGLKSASFLDH

BO16676.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:47:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG8498-PB 90 CG8498-PB 1..90 1..90 470 100 Plus
CG8498-PA 90 CG8498-PA 1..90 1..90 470 100 Plus
Dbi-PA 86 CG8627-PA 4..83 5..84 251 58.8 Plus
Dbi-PB 86 CG8627-PB 4..83 5..84 251 58.8 Plus
CG8629-PA 84 CG8629-PA 4..73 7..76 206 55.7 Plus