Clone BO16680 Report

Search the DGRC for BO16680

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:166
Well:80
Vector:pDNR-Dual
Associated Gene/TranscriptCG12994-RA
Protein status:BO16680.pep:
Sequenced Size:235

Clone Sequence Records

BO16680.3prime Sequence

233 bp (233 high quality bases) assembled on 2006-10-13

> BO16680.3prime
ATGGTCTAGAAAGCTTGCTGCGGTCACGTAGTACTCCCGCTGCCTCTTCT
GGCACTTCTCGCGCGCAATGTAGCACAAGGCGATCGTGATCAGGAGCACT
ATGGTCACGCCCATGCCGATGCTTACCCACATGATCTCCTCGTTGATGCC
CACATAGGAGCGTCCATTGTAGTAGTGATTGGAGTAGCCGGCCTTGCCAG
CCACTCGACCCGCTGGCATGTCGACTGATAACT

BO16680.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG12994-PA 204 CG12994-RA 1..201 219..19 1005 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:25:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG12994-RA 1165 CG12994-RA 426..626 219..19 1005 100 Minus
CG17193-RC 3568 CG17193-RC 269..386 149..29 265 81.8 Minus
CG17193-RB 3915 CG17193-RB 616..733 149..29 265 81.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:25:24
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17422859..17423005 19..165 735 100 Plus
X 23542271 X 17423071..17423126 164..219 280 100 Plus
3R 32079331 3R 20039616..20039720 45..149 240 81.9 Plus
Blast to na_te.dros performed on 2015-02-10 17:25:28 has no hits.

BO16680.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:55:06 Download gff for BO16680.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12994-PA 1..204 18..219 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:40:55 Download gff for BO16680.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 419..631 11..228 96   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:57:08 Download gff for BO16680.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 419..631 11..228 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:57:08 Download gff for BO16680.3prime
Subject Subject Range Query Range Percent Splice Strand
X 17422854..17423004 11..164 97 <- Plus
X 17423072..17423133 165..228 93   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:40:55 Download gff for BO16680.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 17316887..17317037 11..164 97 <- Plus
arm_X 17317105..17317166 165..228 93   Plus

BO16680.5prime Sequence

233 bp (233 high quality bases) assembled on 2006-10-13

> BO16680.5prime
GAAGTTATCAGTCGACATGCCAGCGGGTCGAGTGGCTGGCAAGGCCGGCT
ACTCCAATCACTACTACAATGGACGCTCCTATGTGGGCATCAACGAGGAG
ATCATGTGGGTAAGCATCGGCATGGGCGTGACCATAGTGCTCCTGATCAC
GATCGCCTTGTGCTACATTGCGCGCGAGAAGTGCCAGAAGAGGCAGCGGG
AGTACTACGTGACCGCAGCAAGCTTTCTAGACC

BO16680.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG12994-PA 204 CG12994-RA 1..201 17..217 1005 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 10:15:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG12994-RA 1165 CG12994-RA 426..626 17..217 1005 100 Plus
CG17193-RC 3568 CG17193-RC 269..386 87..207 265 81.8 Plus
CG17193-RB 3915 CG17193-RB 616..733 87..207 265 81.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 10:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17422859..17423005 217..71 735 100 Minus
X 23542271 X 17423071..17423126 72..17 280 100 Minus
3R 32079331 3R 20039616..20039720 191..87 240 81.9 Minus
Blast to na_te.dros performed on 2015-02-06 10:14:56 has no hits.

BO16680.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:55:08 Download gff for BO16680.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12994-PA 1..204 17..218 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 06:39:29 Download gff for BO16680.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 419..631 8..225 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:24:54 Download gff for BO16680.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 419..631 8..225 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:24:54 Download gff for BO16680.5prime
Subject Subject Range Query Range Percent Splice Strand
X 17422854..17423004 72..225 97 <- Minus
X 17423072..17423133 8..71 93   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 06:39:29 Download gff for BO16680.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 17316887..17317037 72..225 97 <- Minus
arm_X 17317105..17317166 8..71 93   Minus

BO16680.complete Sequence

235 bp assembled on 2006-10-11

GenBank Submission: FJ633886

> BO16680.complete
GAAGTTATCAGTCGACATGCCAGCGGGTCGAGTGGCTGGCAAGGCCGGCT
ACTCCAATCACTACTACAATGGACGCTCCTATGTGGGCATCAACGAGGAG
ATCATGTGGGTAAGCATCGGCATGGGCGTGACCATAGTGCTCCTGATCAC
GATCGCCTTGTGCTACATTGCGCGCGAGAAGTGCCAGAAGAGGCAGCGGG
AGTACTACGTGACCGCAGCAAGCTTTCTAGACCAT

BO16680.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:40:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG12994-RA 204 CG12994-PA 1..201 17..217 1005 100 Plus
CG17193-RC 207 CG17193-PC 77..181 87..191 240 81.9 Plus
CG17193-RB 207 CG17193-PB 77..181 87..191 240 81.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:40:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG12994-RA 1165 CG12994-RA 426..626 17..217 1005 100 Plus
CG17193-RC 3568 CG17193-RC 269..373 87..191 240 81.9 Plus
CG17193-RB 3915 CG17193-RB 616..720 87..191 240 81.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:40:21
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17422859..17423005 217..71 735 100 Minus
X 23542271 X 17423071..17423126 72..17 280 100 Minus
3R 32079331 3R 20039616..20039720 191..87 240 81.9 Minus
Blast to na_te.dros performed on 2014-11-27 15:40:21 has no hits.

BO16680.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:53:51 Download gff for BO16680.complete
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 1..204 17..218 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:04:36 Download gff for BO16680.complete
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 419..631 8..225 96   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:52:00 Download gff for BO16680.complete
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 426..626 17..219 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:53:51 Download gff for BO16680.complete
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 419..631 8..225 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:13:31 Download gff for BO16680.complete
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 426..626 17..219 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:13:31 Download gff for BO16680.complete
Subject Subject Range Query Range Percent Splice Strand
X 17423072..17423126 17..71 100   Minus
X 17422857..17423004 72..219 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:52:00 Download gff for BO16680.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17316890..17317037 72..219 98 <- Minus
arm_X 17317105..17317159 17..71 100   Minus

BO16680.pep Sequence

Translation from 16 to 235

> BO16680.pep
MPAGRVAGKAGYSNHYYNGRSYVGINEEIMWVSIGMGVTIVLLITIALCY
IAREKCQKRQREYYVTAASFLDH

BO16680.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:38:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG12994-PA 67 CG12994-PA 1..67 1..67 353 100 Plus
CG17193-PC 68 CG17193-PC 5..68 4..67 216 69.2 Plus
CG17193-PB 68 CG17193-PB 5..68 4..67 216 69.2 Plus
CG17193-PA 68 CG17193-PA 5..68 4..67 216 69.2 Plus