Clone Sequence Records
BO16680.3prime Sequence
233 bp (233 high quality bases) assembled on 2006-10-13
> BO16680.3prime
ATGGTCTAGAAAGCTTGCTGCGGTCACGTAGTACTCCCGCTGCCTCTTCT
GGCACTTCTCGCGCGCAATGTAGCACAAGGCGATCGTGATCAGGAGCACT
ATGGTCACGCCCATGCCGATGCTTACCCACATGATCTCCTCGTTGATGCC
CACATAGGAGCGTCCATTGTAGTAGTGATTGGAGTAGCCGGCCTTGCCAG
CCACTCGACCCGCTGGCATGTCGACTGATAACT
BO16680.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12994-PA | 204 | CG12994-RA | 1..201 | 219..19 | 1005 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:25:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12994-RA | 1165 | CG12994-RA | 426..626 | 219..19 | 1005 | 100 | Minus |
CG17193-RC | 3568 | CG17193-RC | 269..386 | 149..29 | 265 | 81.8 | Minus |
CG17193-RB | 3915 | CG17193-RB | 616..733 | 149..29 | 265 | 81.8 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:25:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 17422859..17423005 | 19..165 | 735 | 100 | Plus |
X | 23542271 | X | 17423071..17423126 | 164..219 | 280 | 100 | Plus |
3R | 32079331 | 3R | 20039616..20039720 | 45..149 | 240 | 81.9 | Plus |
Blast to na_te.dros performed on 2015-02-10 17:25:28 has no hits.
BO16680.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:55:06 Download gff for
BO16680.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12994-PA | 1..204 | 18..219 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:40:55 Download gff for
BO16680.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12994-RA | 419..631 | 11..228 | 96 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:57:08 Download gff for
BO16680.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12994-RA | 419..631 | 11..228 | 96 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:57:08 Download gff for
BO16680.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 17422854..17423004 | 11..164 | 97 | <- | Plus |
X | 17423072..17423133 | 165..228 | 93 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:40:55 Download gff for
BO16680.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 17316887..17317037 | 11..164 | 97 | <- | Plus |
arm_X | 17317105..17317166 | 165..228 | 93 | | Plus |
BO16680.5prime Sequence
233 bp (233 high quality bases) assembled on 2006-10-13
> BO16680.5prime
GAAGTTATCAGTCGACATGCCAGCGGGTCGAGTGGCTGGCAAGGCCGGCT
ACTCCAATCACTACTACAATGGACGCTCCTATGTGGGCATCAACGAGGAG
ATCATGTGGGTAAGCATCGGCATGGGCGTGACCATAGTGCTCCTGATCAC
GATCGCCTTGTGCTACATTGCGCGCGAGAAGTGCCAGAAGAGGCAGCGGG
AGTACTACGTGACCGCAGCAAGCTTTCTAGACC
BO16680.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12994-PA | 204 | CG12994-RA | 1..201 | 17..217 | 1005 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 10:15:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12994-RA | 1165 | CG12994-RA | 426..626 | 17..217 | 1005 | 100 | Plus |
CG17193-RC | 3568 | CG17193-RC | 269..386 | 87..207 | 265 | 81.8 | Plus |
CG17193-RB | 3915 | CG17193-RB | 616..733 | 87..207 | 265 | 81.8 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 10:14:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 17422859..17423005 | 217..71 | 735 | 100 | Minus |
X | 23542271 | X | 17423071..17423126 | 72..17 | 280 | 100 | Minus |
3R | 32079331 | 3R | 20039616..20039720 | 191..87 | 240 | 81.9 | Minus |
Blast to na_te.dros performed on 2015-02-06 10:14:56 has no hits.
BO16680.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:55:08 Download gff for
BO16680.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12994-PA | 1..204 | 17..218 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 06:39:29 Download gff for
BO16680.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12994-RA | 419..631 | 8..225 | 96 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:24:54 Download gff for
BO16680.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12994-RA | 419..631 | 8..225 | 96 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:24:54 Download gff for
BO16680.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 17422854..17423004 | 72..225 | 97 | <- | Minus |
X | 17423072..17423133 | 8..71 | 93 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 06:39:29 Download gff for
BO16680.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 17316887..17317037 | 72..225 | 97 | <- | Minus |
arm_X | 17317105..17317166 | 8..71 | 93 | | Minus |
BO16680.complete Sequence
235 bp assembled on 2006-10-11
GenBank Submission: FJ633886
> BO16680.complete
GAAGTTATCAGTCGACATGCCAGCGGGTCGAGTGGCTGGCAAGGCCGGCT
ACTCCAATCACTACTACAATGGACGCTCCTATGTGGGCATCAACGAGGAG
ATCATGTGGGTAAGCATCGGCATGGGCGTGACCATAGTGCTCCTGATCAC
GATCGCCTTGTGCTACATTGCGCGCGAGAAGTGCCAGAAGAGGCAGCGGG
AGTACTACGTGACCGCAGCAAGCTTTCTAGACCAT
BO16680.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:40:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12994-RA | 204 | CG12994-PA | 1..201 | 17..217 | 1005 | 100 | Plus |
CG17193-RC | 207 | CG17193-PC | 77..181 | 87..191 | 240 | 81.9 | Plus |
CG17193-RB | 207 | CG17193-PB | 77..181 | 87..191 | 240 | 81.9 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:40:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12994-RA | 1165 | CG12994-RA | 426..626 | 17..217 | 1005 | 100 | Plus |
CG17193-RC | 3568 | CG17193-RC | 269..373 | 87..191 | 240 | 81.9 | Plus |
CG17193-RB | 3915 | CG17193-RB | 616..720 | 87..191 | 240 | 81.9 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:40:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 17422859..17423005 | 217..71 | 735 | 100 | Minus |
X | 23542271 | X | 17423071..17423126 | 72..17 | 280 | 100 | Minus |
3R | 32079331 | 3R | 20039616..20039720 | 191..87 | 240 | 81.9 | Minus |
Blast to na_te.dros performed on 2014-11-27 15:40:21 has no hits.
BO16680.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:53:51 Download gff for
BO16680.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12994-RA | 1..204 | 17..218 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:04:36 Download gff for
BO16680.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12994-RA | 419..631 | 8..225 | 96 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:52:00 Download gff for
BO16680.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12994-RA | 426..626 | 17..219 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:53:51 Download gff for
BO16680.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12994-RA | 419..631 | 8..225 | 96 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:13:31 Download gff for
BO16680.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12994-RA | 426..626 | 17..219 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:13:31 Download gff for
BO16680.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 17423072..17423126 | 17..71 | 100 | | Minus |
X | 17422857..17423004 | 72..219 | 98 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:52:00 Download gff for
BO16680.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 17316890..17317037 | 72..219 | 98 | <- | Minus |
arm_X | 17317105..17317159 | 17..71 | 100 | | Minus |
BO16680.pep Sequence
Translation from 16 to 235
> BO16680.pep
MPAGRVAGKAGYSNHYYNGRSYVGINEEIMWVSIGMGVTIVLLITIALCY
IAREKCQKRQREYYVTAASFLDH
BO16680.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:38:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12994-PA | 67 | CG12994-PA | 1..67 | 1..67 | 353 | 100 | Plus |
CG17193-PC | 68 | CG17193-PC | 5..68 | 4..67 | 216 | 69.2 | Plus |
CG17193-PB | 68 | CG17193-PB | 5..68 | 4..67 | 216 | 69.2 | Plus |
CG17193-PA | 68 | CG17193-PA | 5..68 | 4..67 | 216 | 69.2 | Plus |