Clone BO16681 Report

Search the DGRC for BO16681

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:166
Well:81
Vector:pDNR-Dual
Associated Gene/TranscriptCG13306-RA
Protein status:BO16681.pep:
Sequenced Size:316

Clone Sequence Records

BO16681.3prime Sequence

314 bp (314 high quality bases) assembled on 2006-10-13

> BO16681.3prime
ATGGTCTAGAAAGCTTGCATTCAAGAAAAATTCGATAAGGTTGGTCAGCC
GGCGCATGTTGACGTAGTTGACCAGCACGGCGTATGCATAACAGGTGTAG
ATGTAGGCCCACCATTGGAAGTGATACGGCTCCTTGGATCCACCGCCACC
ACGAAGACGTCCGAAACCCATGTAACCATTGCCTTGCAGGATGTGGGCGT
GGTGCCGTTCGGTGAGAAGGCGACGGAATACCGCTCCGCTCAGGTAAACG
ACCGTCAGCAGCAAAATAAGGCGCCGCAGGTGCACCAGTAGCAGAACCAT
GTCGACTGATAACT

BO16681.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG13306-PA 285 CG13306-RA 1..282 300..19 1410 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:04:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG13306-RA 531 CG13306-RA 111..392 300..19 1410 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:04:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8749278..8749559 19..300 1410 100 Plus
Blast to na_te.dros performed on 2015-02-12 11:04:36 has no hits.

BO16681.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:55:08 Download gff for BO16681.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13306-PA 1..285 15..300 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:43:47 Download gff for BO16681.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 111..400 11..300 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:18:41 Download gff for BO16681.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 111..400 11..300 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:18:41 Download gff for BO16681.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 8749270..8749559 11..300 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:43:47 Download gff for BO16681.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8742370..8742659 11..300 98   Plus

BO16681.5prime Sequence

314 bp (314 high quality bases) assembled on 2006-10-13

> BO16681.5prime
GAAGTTATCAGTCGACATGGTTCTGCTACTGGTGCACCTGCGGCGCCTTA
TTTTGCTGCTGACGGTCGTTTACCTGAGCGGAGCGGTATTCCGTCGCCTT
CTCACCGAACGGCACCACGCCCACATCCTGCAAGGCAATGGTTACATGGG
TTTCGGACGTCTTCGTGGTGGCGGTGGATCCAAGGAGCCGTATCACTTCC
AATGGTGGGCCTACATCTACACCTGTTATGCATACGCCGTGCTGGTCAAC
TACGTCAACATGCGCCGGCTGACCAACCTTATCGAATTTTTCTTGAATGC
AAGCTTTCTAGACC

BO16681.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG13306-PA 285 CG13306-RA 1..282 17..298 1410 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:07:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG13306-RA 531 CG13306-RA 111..392 17..298 1410 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 09:07:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8749278..8749559 298..17 1410 100 Minus
Blast to na_te.dros performed on 2015-02-11 09:07:24 has no hits.

BO16681.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:55:09 Download gff for BO16681.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13306-PA 1..285 17..302 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 17:00:27 Download gff for BO16681.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 111..400 17..306 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:53:22 Download gff for BO16681.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 111..400 17..306 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 10:53:22 Download gff for BO16681.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 8749270..8749559 17..306 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 17:00:27 Download gff for BO16681.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8742370..8742659 17..306 98   Minus

BO16681.complete Sequence

316 bp assembled on 2006-10-11

GenBank Submission: FJ633887

> BO16681.complete
GAAGTTATCAGTCGACATGGTTCTGCTACTGGTGCACCTGCGGCGCCTTA
TTTTGCTGCTGACGGTCGTTTACCTGAGCGGAGCGGTATTCCGTCGCCTT
CTCACCGAACGGCACCACGCCCACATCCTGCAAGGCAATGGTTACATGGG
TTTCGGACGTCTTCGTGGTGGCGGTGGATCCAAGGAGCCGTATCACTTCC
AATGGTGGGCCTACATCTACACCTGTTATGCATACGCCGTGCTGGTCAAC
TACGTCAACATGCGCCGGCTGACCAACCTTATCGAATTTTTCTTGAATGC
AAGCTTTCTAGACCAT

BO16681.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 19:58:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG13306-RA 285 CG13306-PA 1..282 17..298 1410 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 19:58:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG13306-RA 531 CG13306-RA 111..392 17..298 1410 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 19:58:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8749278..8749559 298..17 1410 100 Minus
Blast to na_te.dros performed on 2014-11-27 19:58:22 has no hits.

BO16681.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:05:12 Download gff for BO16681.complete
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 1..285 17..302 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:19:59 Download gff for BO16681.complete
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 111..400 17..306 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:01:32 Download gff for BO16681.complete
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 111..392 17..300 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:05:13 Download gff for BO16681.complete
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 111..400 17..306 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:11:47 Download gff for BO16681.complete
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 111..392 17..300 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:11:47 Download gff for BO16681.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8749276..8749559 17..300 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:01:32 Download gff for BO16681.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8742376..8742659 17..300 99   Minus

BO16681.pep Sequence

Translation from 16 to 316

> BO16681.pep
MVLLLVHLRRLILLLTVVYLSGAVFRRLLTERHHAHILQGNGYMGFGRLR
GGGGSKEPYHFQWWAYIYTCYAYAVLVNYVNMRRLTNLIEFFLNASFLDH

BO16681.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG13306-PA 94 CG13306-PA 1..94 1..94 502 100 Plus