Clone BO16687 Report

Search the DGRC for BO16687

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:166
Well:87
Vector:pDNR-Dual
Associated Gene/TranscriptCG14483-RA
Protein status:BO16687.pep: validated full length
Sequenced Size:280

Clone Sequence Records

BO16687.3prime Sequence

278 bp (278 high quality bases) assembled on 2006-10-13

> BO16687.3prime
ATGGTCTAGAAAGCTTGCCTTCTTCTGCTTGCCCTCCGCCTCCTCCATAG
CACGCATCATTTTGGCGTCGTGCTGGGCGTGGTGTTCACGGATTGCCCGC
TGCAGCTCCTCGTGGTGGCTTTTGCTTTCCGGCGGATAAAGTTCCCGCTT
CTTCTTGGTCACCCATTCTTCAAAGTATTCCGGCTGGTTAAACAAGTGGA
ATAGCGTCACCGGAAAGGCCATGTACATGCCCATCTTGGCCACCTCCAGC
ACCCAGGTTCCCATGTCGACTGATAACT

BO16687.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG14483-PA 249 CG14483-RA 1..246 264..19 1230 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 11:48:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG14483-RC 955 CG14483-RC 108..357 268..19 1235 99.6 Minus
CG14483-RB 437 CG14483-RB 30..279 268..19 1235 99.6 Minus
CG14483-RA 515 CG14483-RA 108..357 268..19 1235 99.6 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 11:47:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17585793..17586042 19..268 1235 99.6 Plus
Blast to na_te.dros performed on 2015-02-08 11:48:02 has no hits.

BO16687.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:55:12 Download gff for BO16687.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14483-PA 1..249 18..264 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:37:02 Download gff for BO16687.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 101..357 19..278 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 13:42:18 Download gff for BO16687.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 101..357 19..278 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 13:42:18 Download gff for BO16687.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 17585793..17586049 19..278 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:37:02 Download gff for BO16687.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13473298..13473554 19..278 98   Plus

BO16687.5prime Sequence

278 bp (278 high quality bases) assembled on 2006-10-13

> BO16687.5prime
GAAGTTATCAGTCGACATGGGAACCTGGGTGCTGGAGGTGGCCAAGATGG
GCATGTACATGGCCTTTCCGGTGACGCTATTCCACTTGTTTAACCAGCCG
GAATACTTTGAAGAATGGGTGACCAAGAAGAAGCGGGAACTTTATCCGCC
GGAAAGCAAAAGCCACCACGAGGAGCTGCAGCGGGCAATCCGTGAACACC
ACGCCCAGCACGACGCCAAAATGATGCGTGCTATGGAGGAGGCGGAGGGC
AAGCAGAAGAAGGCAAGCTTTCTAGACC

BO16687.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG14483-PA 249 CG14483-RA 1..246 17..262 1230 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 03:51:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG14483-RC 955 CG14483-RC 108..357 13..262 1235 99.6 Plus
CG14483-RB 437 CG14483-RB 30..279 13..262 1235 99.6 Plus
CG14483-RA 515 CG14483-RA 108..357 13..262 1235 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 03:51:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17585793..17586042 262..13 1235 99.6 Minus
Blast to na_te.dros performed on 2015-02-12 03:51:20 has no hits.

BO16687.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:55:12 Download gff for BO16687.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14483-PA 1..249 17..263 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 21:30:51 Download gff for BO16687.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 102..357 5..262 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:58:08 Download gff for BO16687.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 102..357 5..262 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 06:58:08 Download gff for BO16687.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 17585793..17586048 5..262 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 21:30:51 Download gff for BO16687.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13473298..13473553 5..262 98   Minus

BO16687.complete Sequence

280 bp assembled on 2006-10-11

GenBank Submission: FJ633888

> BO16687.complete
GAAGTTATCAGTCGACATGGGAACCTGGGTGCTGGAGGTGGCCAAGATGG
GCATGTACATGGCCTTTCCGGTGACGCTATTCCACTTGTTTAACCAGCCG
GAATACTTTGAAGAATGGGTGACCAAGAAGAAGCGGGAACTTTATCCGCC
GGAAAGCAAAAGCCACCACGAGGAGCTGCAGCGGGCAATCCGTGAACACC
ACGCCCAGCACGACGCCAAAATGATGCGTGCTATGGAGGAGGCGGAGGGC
AAGCAGAAGAAGGCAAGCTTTCTAGACCAT

BO16687.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG14483-RC 249 CG14483-PC 1..246 17..262 1230 100 Plus
CG14483-RB 249 CG14483-PB 1..246 17..262 1230 100 Plus
CG14483-RA 249 CG14483-PA 1..246 17..262 1230 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG14483-RC 955 CG14483-RC 108..357 13..262 1235 99.6 Plus
CG14483-RB 437 CG14483-RB 30..279 13..262 1235 99.6 Plus
CG14483-RA 515 CG14483-RA 108..357 13..262 1235 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17585793..17586042 262..13 1235 99.6 Minus
Blast to na_te.dros performed on 2014-11-27 15:36:28 has no hits.

BO16687.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:48 Download gff for BO16687.complete
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 1..249 17..263 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:19:23 Download gff for BO16687.complete
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 43..298 5..262 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:51:27 Download gff for BO16687.complete
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 112..357 17..264 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:48 Download gff for BO16687.complete
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 43..298 5..262 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:11:59 Download gff for BO16687.complete
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 112..357 17..264 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:11:59 Download gff for BO16687.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17585791..17586038 17..264 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:51:27 Download gff for BO16687.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13473296..13473543 17..264 99   Minus

BO16687.pep Sequence

Translation from 16 to 280

> BO16687.pep
MGTWVLEVAKMGMYMAFPVTLFHLFNQPEYFEEWVTKKKRELYPPESKSH
HEELQRAIREHHAQHDAKMMRAMEEAEGKQKKASFLDH

BO16687.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:22:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG14483-PC 82 CG14483-PC 1..82 1..82 444 100 Plus
CG14483-PB 82 CG14483-PB 1..82 1..82 444 100 Plus
CG14483-PA 82 CG14483-PA 1..82 1..82 444 100 Plus