Clone BO16692 Report

Search the DGRC for BO16692

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:166
Well:92
Vector:pDNR-Dual
Associated Gene/TranscriptCG15578-RA
Protein status:BO16692.pep: validated full length
Sequenced Size:301

Clone Sequence Records

BO16692.3prime Sequence

299 bp (299 high quality bases) assembled on 2006-10-13

> BO16692.3prime
ATGGTCTAGAAAGCTTGCAAGGTTCATCGGTTTGGTGAGGATCCAAGCGA
GCAGCGAAATCTGGTTTCCCTGGCGCCTCAGAATGGCGCTTTCGATGCCA
TCGTGCAGATTGATTTGCACTTGGGCAAAGAATTCCGGATCGTTACGTTG
GTACTGGCTGCCCAGGAAGATGTTCAGCTCTGTGTCAGTCATGGGTCGGC
TAGTATGCTCCAGGACCATTATAATGGACTTAAGTAGGTTGGGTACCAAC
CGACGTTTCGGCAGTGTCGTGAAGATGTCGGCCATGTCGACTGATAACT

BO16692.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG15578-PA 270 CG15578-RA 1..267 285..19 1335 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG15578-RA 415 CG15578-RA 98..366 287..19 1345 100 Minus
CG15577-RA 508 CG15577-RA 139..338 250..51 475 82.5 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:36:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4277596..4277864 19..287 1345 100 Plus
X 23542271 X 4276663..4276862 51..250 475 82.5 Plus
Blast to na_te.dros performed on 2015-02-10 16:36:26 has no hits.

BO16692.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:55:18 Download gff for BO16692.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15578-PA 1..270 16..285 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 20:18:11 Download gff for BO16692.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15578-RA 98..370 15..287 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:03:19 Download gff for BO16692.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15578-RA 98..370 15..287 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:03:19 Download gff for BO16692.3prime
Subject Subject Range Query Range Percent Splice Strand
X 4277591..4277864 15..287 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 20:18:11 Download gff for BO16692.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 4171624..4171897 15..287 99   Plus

BO16692.5prime Sequence

299 bp (299 high quality bases) assembled on 2006-10-13

> BO16692.5prime
GAAGTTATCAGTCGACATGGCCGACATCTTCACGACACTGCCGAAACGTC
GGTTGGTACCCAACCTACTTAAGTCCATTATAATGGTCCTGGAGCATACT
AGCCGACCCATGACTGACACAGAGCTGAACATCTTCCTGGGCAGCCAGTA
CCAACGTAACGATCCGGAATTCTTTGCCCAAGTGCAAATCAATCTGCACG
ATGGCATCGAAAGCGCCATTCTGAGGCGCCAGGGAAACCAGATTTCGCTG
CTCGCTTGGATCCTCACCAAACCGATGAACCTTGCAAGCTTTCTAGACC

BO16692.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG15578-PA 270 CG15578-RA 1..267 17..283 1335 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 03:51:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG15578-RA 415 CG15578-RA 98..366 15..283 1345 100 Plus
CG15577-RA 508 CG15577-RA 139..338 52..251 475 82.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 03:51:28
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4277596..4277864 283..15 1345 100 Minus
X 23542271 X 4276663..4276862 251..52 475 82.5 Minus
Blast to na_te.dros performed on 2015-02-12 03:51:29 has no hits.

BO16692.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:55:19 Download gff for BO16692.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15578-PA 1..270 17..286 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 21:30:53 Download gff for BO16692.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15578-RA 98..370 15..287 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:58:28 Download gff for BO16692.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15578-RA 98..370 15..287 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 06:58:28 Download gff for BO16692.5prime
Subject Subject Range Query Range Percent Splice Strand
X 4277591..4277864 15..287 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 21:30:53 Download gff for BO16692.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 4171624..4171897 15..287 99   Minus

BO16692.complete Sequence

301 bp assembled on 2006-10-11

GenBank Submission: FJ633890

> BO16692.complete
GAAGTTATCAGTCGACATGGCCGACATCTTCACGACACTGCCGAAACGTC
GGTTGGTACCCAACCTACTTAAGTCCATTATAATGGTCCTGGAGCATACT
AGCCGACCCATGACTGACACAGAGCTGAACATCTTCCTGGGCAGCCAGTA
CCAACGTAACGATCCGGAATTCTTTGCCCAAGTGCAAATCAATCTGCACG
ATGGCATCGAAAGCGCCATTCTGAGGCGCCAGGGAAACCAGATTTCGCTG
CTCGCTTGGATCCTCACCAAACCGATGAACCTTGCAAGCTTTCTAGACCA
T

BO16692.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:12:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG15578-RA 270 CG15578-PA 1..267 17..283 1335 100 Plus
CG15577-RA 300 CG15577-PA 45..244 52..251 475 82.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:12:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG15578-RA 415 CG15578-RA 98..366 15..283 1345 100 Plus
CG15577-RA 508 CG15577-RA 139..338 52..251 475 82.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:12:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4277596..4277864 283..15 1345 100 Minus
X 23542271 X 4276663..4276862 251..52 475 82.5 Minus
Blast to na_te.dros performed on 2014-11-27 15:12:56 has no hits.

BO16692.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:05:15 Download gff for BO16692.complete
Subject Subject Range Query Range Percent Splice Strand
CG15578-RA 1..270 17..286 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:20:02 Download gff for BO16692.complete
Subject Subject Range Query Range Percent Splice Strand
CG15578-RA 1..270 17..286 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:44:56 Download gff for BO16692.complete
Subject Subject Range Query Range Percent Splice Strand
CG15578-RA 100..366 17..285 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:05:15 Download gff for BO16692.complete
Subject Subject Range Query Range Percent Splice Strand
CG15578-RA 1..270 17..286 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:02:35 Download gff for BO16692.complete
Subject Subject Range Query Range Percent Splice Strand
CG15578-RA 100..366 17..285 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:02:35 Download gff for BO16692.complete
Subject Subject Range Query Range Percent Splice Strand
X 4277593..4277862 17..285 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:44:56 Download gff for BO16692.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4171626..4171895 17..285 99   Minus

BO16692.pep Sequence

Translation from 16 to 301

> BO16692.pep
MADIFTTLPKRRLVPNLLKSIIMVLEHTSRPMTDTELNIFLGSQYQRNDP
EFFAQVQINLHDGIESAILRRQGNQISLLAWILTKPMNLASFLDH

BO16692.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:47:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG15578-PA 89 CG15578-PA 1..89 1..89 452 100 Plus
CG15577-PA 99 CG15577-PA 9..81 7..78 254 68.5 Plus