Clone BO16696 Report

Search the DGRC for BO16696

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:166
Well:96
Vector:pDNR-Dual
Associated Gene/TranscriptCG17776-RA
Protein status:BO16696.pep: validated full length
Sequenced Size:244

Clone Sequence Records

BO16696.5prime Sequence

242 bp (242 high quality bases) assembled on 2006-10-13

> BO16696.5prime
GAAGTTATCAGTCGACATGCAGAAGAAGCCGATTAACACCAACACGCTGC
TGGACAAGCTGCACCGCGGCGCGGTGTATGCCTGCATTGGAGTCACCCTG
TACGGCACCTACATCCTGGGAATGCGCTACTACCACTACTGCACGGTCAT
CCGACCGGAGAAGCAGCAGGCGGAGCTGAAGCTCCTGGACGAGGGAGCCC
ACGACAAGGCCAAGGAACTGAAGTACGCAAGCTTTCTAGACC

BO16696.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 16:28:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG17776-PA 213 CG17776-RA 1..210 17..226 1050 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:26:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG17776-RB 534 CG17776-RB 240..450 16..226 1055 100 Plus
CG17776-RA 372 CG17776-RA 78..288 16..226 1055 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:26:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2184964..2185174 16..226 1055 100 Plus
Blast to na_te.dros performed on 2015-02-10 16:26:11 has no hits.

BO16696.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:55:23 Download gff for BO16696.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17776-PA 1..213 17..227 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-19 23:09:29 Download gff for BO16696.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17776-RA 69..293 7..232 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:48:25 Download gff for BO16696.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17776-RA 69..293 7..232 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:48:25 Download gff for BO16696.5prime
Subject Subject Range Query Range Percent Splice Strand
X 2184955..2185179 7..232 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 23:09:29 Download gff for BO16696.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 2078988..2079212 7..232 96   Plus

BO16696.complete Sequence

244 bp assembled on 2007-10-29

GenBank Submission: FJ633892

> BO16696.complete
GAAGTTATCAGTCGACATGCAGAAGAAGCCGATTAACACCAACACGCTGC
TGGACAAGCTGCACCGCGGCGCGGTGTATGCCTGCATTGGAGTCACCCTG
TACGGCACCTACATCCTGGGAATGCGCTACTACCACTACTGCACGGTCAT
CCGACCGGAGAAGCAGCAGGCGGAGCTGAAGCTCCTGGACGAGGGAGCCC
ACGACAAGGCCAAGGAACTGAAGTACGCAAGCTTTCTAGACCAT

BO16696.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:16:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG17776-RB 213 CG17776-PB 1..210 17..226 1050 100 Plus
CG17776-RA 213 CG17776-PA 1..210 17..226 1050 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:16:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG17776-RB 534 CG17776-RB 240..450 16..226 1055 100 Plus
CG17776-RA 372 CG17776-RA 78..288 16..226 1055 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:16:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2184964..2185174 16..226 1055 100 Plus
Blast to na_te.dros performed on 2014-11-27 20:16:02 has no hits.

BO16696.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:03:13 Download gff for BO16696.complete
Subject Subject Range Query Range Percent Splice Strand
CG17776-RA 1..213 17..227 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:11:35 Download gff for BO16696.complete
Subject Subject Range Query Range Percent Splice Strand
CG17776-RA 16..240 7..232 96   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:05:47 Download gff for BO16696.complete
Subject Subject Range Query Range Percent Splice Strand
CG17776-RA 79..288 17..228 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:36:19 Download gff for BO16696.complete
Subject Subject Range Query Range Percent Splice Strand
CG17776-RA 26..235 17..228 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:18:21 Download gff for BO16696.complete
Subject Subject Range Query Range Percent Splice Strand
CG17776-RA 79..288 17..228 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:18:21 Download gff for BO16696.complete
Subject Subject Range Query Range Percent Splice Strand
X 2184965..2185174 17..228 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:05:47 Download gff for BO16696.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2078998..2079207 17..228 99   Plus

BO16696.pep Sequence

Translation from 16 to 244

> BO16696.pep
MQKKPINTNTLLDKLHRGAVYACIGVTLYGTYILGMRYYHYCTVIRPEKQ
QAELKLLDEGAHDKAKELKYASFLDH

BO16696.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:28:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG17776-PB 70 CG17776-PB 1..70 1..70 374 100 Plus
CG17776-PA 70 CG17776-PA 1..70 1..70 374 100 Plus