Clone Sequence Records
BO16739.5prime Sequence
323 bp (323 high quality bases) assembled on 2006-10-13
> BO16739.5prime
GAAGTTATCAGTCGACATGTCCGCCGAAGTGGAGGAACTATTGAAGCGCT
TTCAGTCCATGAAGAACGTCACCGGCATAGTTGTGGTGGACAACGACGGC
ATTCCGATCAAAACGACCCTGGACTACACTCTGACACTCCACTACGCGGC
ACTGATGCAAACGGTGCGGGAGAAGGCTCGCCAGGTGGTCCTGGATCTGG
ACGCCACCAACGAATTCACCTTCCTGCGGCTGCGGACTGAGCAGAATGAG
GTGATGCTGTGCCCGCAGGAAGATTACTTCATCATGGTGATCCAGAGCCC
GTGCGACGCAAGCTTTCTAGACC
BO16739.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG10838-PA | 294 | robl22E-RA | 1..291 | 17..307 | 1455 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-31 10:07:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
robl22E-RB | 454 | CG10838-RB | 56..346 | 17..307 | 1455 | 100 | Plus |
robl22E-RA | 475 | CG10838-RA | 77..367 | 17..307 | 1455 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-01-31 10:07:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 2290332..2290622 | 307..17 | 1455 | 100 | Minus |
Blast to na_te.dros performed on 2015-01-31 10:07:41 has no hits.
BO16739.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:55:24 Download gff for
BO16739.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10838-PA | 1..294 | 17..308 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 23:33:30 Download gff for
BO16739.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
robl22E-RA | 74..373 | 10..313 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-31 12:43:03 Download gff for
BO16739.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
robl22E-RA | 74..373 | 10..313 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-31 12:43:03 Download gff for
BO16739.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2290326..2290625 | 10..313 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 23:33:30 Download gff for
BO16739.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 2290326..2290625 | 10..313 | 97 | | Minus |
BO16739.complete Sequence
325 bp assembled on 2006-10-11
GenBank Submission: FJ633893
> BO16739.complete
GAAGTTATCAGTCGACATGTCCGCCGAAGTGGAGGAACTATTGAAGCGCT
TTCAGTCCATGAAGAACGTCACCGGCATAGTTGTGGTGGACAACGACGGC
ATTCCGATCAAAACGACCCTGGACTACACTCTGACACTCCACTACGCGGC
ACTGATGCAAACGGTGCGGGAGAAGGCTCGCCAGGTGGTCCTGGATCTGG
ACGCCACCAACGAATTCACCTTCCTGCGGCTGCGGACTGAGCAGAATGAG
GTGATGCTGTGCCCGCAGGAAGATTACTTCATCATGGTGATCCAGAGCCC
GTGCGACGCAAGCTTTCTAGACCAT
BO16739.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:04:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
robl22E-RB | 294 | CG10838-PB | 1..291 | 17..307 | 1455 | 100 | Plus |
robl22E-RA | 294 | CG10838-PA | 1..291 | 17..307 | 1455 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:04:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
robl22E-RB | 454 | CG10838-RB | 56..346 | 17..307 | 1455 | 100 | Plus |
robl22E-RA | 475 | CG10838-RA | 77..367 | 17..307 | 1455 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:04:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 2290332..2290622 | 307..17 | 1455 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 07:04:30 has no hits.
BO16739.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:05:22 Download gff for
BO16739.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
robl22E-RA | 1..294 | 17..308 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:20:15 Download gff for
BO16739.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
robl22E-RA | 1..294 | 17..308 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:04:14 Download gff for
BO16739.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
robl22E-RA | 77..367 | 17..309 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:05:22 Download gff for
BO16739.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
robl22E-RA | 1..294 | 17..308 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:02:18 Download gff for
BO16739.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
robl22E-RA | 77..367 | 17..309 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:02:18 Download gff for
BO16739.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2290330..2290622 | 17..309 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:04:14 Download gff for
BO16739.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 2290330..2290622 | 17..309 | 99 | | Minus |
BO16739.pep Sequence
Translation from 16 to 325
> BO16739.pep
MSAEVEELLKRFQSMKNVTGIVVVDNDGIPIKTTLDYTLTLHYAALMQTV
REKARQVVLDLDATNEFTFLRLRTEQNEVMLCPQEDYFIMVIQSPCDASF
LDH
BO16739.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:47:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
robl22E-PB | 97 | CG10838-PB | 1..97 | 1..97 | 491 | 100 | Plus |
robl22E-PA | 97 | CG10838-PA | 1..97 | 1..97 | 491 | 100 | Plus |
robl-PA | 97 | CG10751-PA | 1..97 | 1..97 | 285 | 54.6 | Plus |
CG10834-PA | 97 | CG10834-PA | 1..95 | 1..95 | 282 | 53.7 | Plus |
CG10822-PA | 114 | CG10822-PA | 15..107 | 5..97 | 158 | 31.2 | Plus |