Clone Sequence Records
BO16749.complete Sequence
232 bp assembled on 2008-11-10
GenBank Submission: KX796408
> BO16749.complete
GAAGTTATCAGTCGACATGATTCGAATTTTGGTTTTAATGATTACATTCA
CTCTAATGACTGGTAGCGCTCTTTGTTCTATCGAGCAACTTATGCGGGTC
TTTGGCGGTGGATCTGTTGGAGGAGGTTCTAGGCTGGACATCAACAGAAG
GGTAACTATAGTACCACCCGAAGGCGAACTCTCGTTTGGATATGGCTTTC
GTCCTGGATTCTATGCAAGCTTTCTAGACCAT
BO16749.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:50:02
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| PebII-RB | 201 | CG2665-PB | 1..198 | 17..214 | 990 | 100 | Plus |
| PebII-RA | 201 | CG2665-PA | 1..198 | 17..214 | 990 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:50:04
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| PebII-RB | 608 | CG2665-RB | 48..246 | 16..214 | 995 | 100 | Plus |
| PebII-RA | 379 | CG2665-RA | 48..246 | 16..214 | 995 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:50:01
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 25173930..25174113 | 214..31 | 920 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 07:50:02 has no hits.
BO16749.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:18:21 Download gff for
BO16749.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| PebII-RA | 21..222 | 9..214 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:53:29 Download gff for
BO16749.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| PebII-RA | 25..222 | 17..216 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-11 13:12:44 Download gff for
BO16749.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| PebII-RA | 7..204 | 17..216 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:05:36 Download gff for
BO16749.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| PebII-RA | 49..246 | 17..216 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:05:36 Download gff for
BO16749.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 25173927..25174112 | 32..216 | 98 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:53:29 Download gff for
BO16749.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 21061450..21061635 | 32..216 | 98 | <- | Minus |
BO16749.3prime Sequence
230 bp (230 high quality bases) assembled on 2006-10-13
> BO16749.3prime
ATGGTCTAGAAAGCTTGCATATAATCCAGGACGAAAGCCATATCCAAACG
AGAGTTCGCCTTCGGGTGGTACTATAGTTACCCTTCTGTTGATGTCCAGC
CTAGAACCTCCTCCAACAGATCCACCGCCAAAGACCCGCATAAGTTGCTC
GATAGAACAAAGAGCGCTACCAGTCATTAGAGTGAATGTAATCATTAAAA
CCAAAATTCGAATCATGTCGACTGATAACT
BO16749.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 16:29:48
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG2665-PA | 201 | PebII-RA | 1..194 | 216..23 | 970 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:06:59
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| PebII-RB | 608 | CG2665-RB | 48..246 | 217..19 | 980 | 99.5 | Minus |
| PebII-RA | 379 | CG2665-RA | 48..246 | 217..19 | 980 | 99.5 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:06:52
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 25173930..25174113 | 19..202 | 905 | 99.5 | Plus |
Blast to na_te.dros performed on 2015-02-11 17:06:55 has no hits.
BO16749.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:55:39 Download gff for
BO16749.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG2665-PA | 1..201 | 16..216 | 98 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 10:18:20 Download gff for
BO16749.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| PebII-RA | 21..222 | 19..224 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:12:19 Download gff for
BO16749.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| PebII-RA | 45..246 | 19..224 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:12:19 Download gff for
BO16749.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 25173930..25174112 | 19..201 | 99 | <- | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 10:18:20 Download gff for
BO16749.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 21061453..21061635 | 19..201 | 99 | <- | Plus |
BO16749.5prime Sequence
230 bp (230 high quality bases) assembled on 2006-10-13
> BO16749.5prime
GAAGTTATCCGTCGACATGATTCGAATTTTGGTTTTAATGATTACATTCA
CTCTAATGACTGGTAGCGCTCTTTGTTCTATCGAGCAACTTATGCGGGTC
TTTGGCGGTGGATCTGTTGGAGGAGGTTCTAGGCTGGACATCAACAGAAG
GGTAACTATAGTACCACCCGAAGGCGAACTCTCGTTTGGATATGGCTTTC
GTCCTGGATTCTATGCAAGCTTTCTAGACC
BO16749.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 16:29:54
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG2665-PA | 201 | PebII-RA | 1..198 | 17..214 | 990 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-30 19:10:07
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| PebII-RB | 608 | CG2665-RB | 48..246 | 16..214 | 995 | 100 | Plus |
| PebII-RA | 379 | CG2665-RA | 48..246 | 16..214 | 995 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-01-30 19:10:01
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 25173930..25174113 | 214..31 | 920 | 100 | Minus |
Blast to na_te.dros performed on 2015-01-30 19:10:04 has no hits.
BO16749.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:55:40 Download gff for
BO16749.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG2665-PA | 1..201 | 17..217 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-05 19:31:52 Download gff for
BO16749.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| PebII-RA | 24..222 | 16..214 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-30 19:48:36 Download gff for
BO16749.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| PebII-RA | 48..246 | 16..214 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-30 19:48:36 Download gff for
BO16749.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 25173930..25174112 | 32..214 | 100 | <- | Minus |
| 2R | 25174168..25174183 | 16..31 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-05 19:31:52 Download gff for
BO16749.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 21061453..21061635 | 32..214 | 100 | <- | Minus |
| arm_2R | 21061691..21061706 | 16..31 | 100 | | Minus |
BO16749.pep Sequence
Translation from 16 to 232
> BO16749.pep
MIRILVLMITFTLMTGSALCSIEQLMRVFGGGSVGGGSRLDINRRVTIVP
PEGELSFGYGFRPGFYASFLDH
BO16749.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:05:02
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| PebII-PB | 66 | CG2665-PB | 1..66 | 1..66 | 338 | 100 | Plus |
| PebII-PA | 66 | CG2665-PA | 1..66 | 1..66 | 338 | 100 | Plus |
