Clone BO16760 Report

Search the DGRC for BO16760

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:167
Well:60
Vector:pDNR-Dual
Associated Gene/Transcriptrpr-RA
Protein status:BO16760.pep:
Sequenced Size:229

Clone Sequence Records

BO16760.3prime Sequence

227 bp (227 high quality bases) assembled on 2006-10-13

> BO16760.3prime
ATGGTCTAGAAAGCTTGCTTGCGATGGCTTGCGATATTTGCCGGACTTTC
TTCCGGTCTTCGGATGACATGAAGTGTACTGGCGCAGGGTTTCCAGGACG
ACGGTGGCCAGGAATCTCCACTGTGACTCCCGCAAGCGAAGGATCTGCTG
CTCCTTCTGCTCCGCCTCCCGCAACAGAGTCGCCTGATCGGGTATGTAGA
ATGCCACTGCCATGTCGACTGATAACT

BO16760.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG4319-PA 198 rpr-RA 1..195 213..19 975 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 17:53:36
Subject Length Description Subject Range Query Range Score Percent Strand
rpr-RA 901 CG4319-RA 201..395 213..19 975 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 17:53:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18398041..18398235 19..213 975 100 Plus
Blast to na_te.dros performed on 2015-02-02 17:53:33 has no hits.

BO16760.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:55:53 Download gff for BO16760.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4319-PA 1..198 16..213 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 15:40:22 Download gff for BO16760.3prime
Subject Subject Range Query Range Percent Splice Strand
rpr-RA 196..403 11..221 96   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 19:12:05 Download gff for BO16760.3prime
Subject Subject Range Query Range Percent Splice Strand
rpr-RA 196..403 11..221 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 19:12:05 Download gff for BO16760.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 18398033..18398240 11..221 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 15:40:22 Download gff for BO16760.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18391133..18391340 11..221 96   Plus

BO16760.5prime Sequence

227 bp (227 high quality bases) assembled on 2006-10-13

> BO16760.5prime
GAAGTTATCCCTTGACATGGCAGTGGCATTCTACATACCCGATCAGGCGA
CTCTGTTGCGGGAGGCGGAGCAGAAGGAGCAGCAGATCCTTCGCTTGCGG
GAGTCACAGTGGAGATTCCTGGCCACCGTCGTCCTGGAAACCCTGCGCCA
GTACACTTCATGTCATCCGAAGACCGGAAGAAAGTCCGGCAAATATCGCA
AGCCATCGCAAGCAAGCTTTCTAGACC

BO16760.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG4319-PA 198 rpr-RA 1..195 17..211 975 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:05:33
Subject Length Description Subject Range Query Range Score Percent Strand
rpr-RA 901 CG4319-RA 201..395 17..211 975 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:05:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18398041..18398235 211..17 975 100 Minus
Blast to na_te.dros performed on 2015-02-12 11:05:31 has no hits.

BO16760.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:55:54 Download gff for BO16760.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4319-PA 1..198 17..214 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:44:02 Download gff for BO16760.5prime
Subject Subject Range Query Range Percent Splice Strand
rpr-RA 195..403 10..219 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:20:24 Download gff for BO16760.5prime
Subject Subject Range Query Range Percent Splice Strand
rpr-RA 195..403 10..219 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:20:24 Download gff for BO16760.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 18398033..18398241 10..219 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:44:02 Download gff for BO16760.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18391133..18391341 10..219 96   Minus

BO16760.complete Sequence

229 bp assembled on 2006-10-11

GenBank Submission: FJ633903

> BO16760.complete
GAAGTTATCAGTCGACATGGCAGTGGCATTCTACATACCCGATCAGGCGA
CTCTGTTGCGGGAGGCGGAGCAGAAGGAGCAGCAGATCCTTCGCTTGCGG
GAGTCACAGTGGAGATTCCTGGCCACCGTCGTCCTGGAAACCCTGCGCCA
GTACACTTCATGTCATCCGAAGACCGGAAGAAAGTCCGGCAAATATCGCA
AGCCATCGCAAGCAAGCTTTCTAGACCAT

BO16760.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:11:30
Subject Length Description Subject Range Query Range Score Percent Strand
rpr-RA 198 CG4319-PA 1..195 17..211 975 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
rpr-RA 901 CG4319-RA 201..395 17..211 975 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18398041..18398235 211..17 975 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:11:28 has no hits.

BO16760.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:41 Download gff for BO16760.complete
Subject Subject Range Query Range Percent Splice Strand
rpr-RA 1..198 17..214 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:19:11 Download gff for BO16760.complete
Subject Subject Range Query Range Percent Splice Strand
rpr-RA 164..371 9..219 96   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:04:54 Download gff for BO16760.complete
Subject Subject Range Query Range Percent Splice Strand
rpr-RA 201..395 17..213 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:42 Download gff for BO16760.complete
Subject Subject Range Query Range Percent Splice Strand
rpr-RA 164..371 9..219 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:12:51 Download gff for BO16760.complete
Subject Subject Range Query Range Percent Splice Strand
rpr-RA 201..395 17..213 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:12:51 Download gff for BO16760.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18398038..18398235 17..213 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:04:54 Download gff for BO16760.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18391138..18391335 17..213 98   Minus

BO16760.pep Sequence

Translation from 16 to 229

> BO16760.pep
MAVAFYIPDQATLLREAEQKEQQILRLRESQWRFLATVVLETLRQYTSCH
PKTGRKSGKYRKPSQASFLDH

BO16760.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:22:27
Subject Length Description Subject Range Query Range Score Percent Strand
rpr-PA 65 CG4319-PA 1..65 1..65 334 100 Plus