Clone BO16767 Report

Search the DGRC for BO16767

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:167
Well:67
Vector:pDNR-Dual
Associated Gene/TranscriptskpB-RA
Protein status:BO16767.pep: full length peptide match
Sequenced Size:517

Clone Sequence Records

BO16767.3prime Sequence

515 bp (515 high quality bases) assembled on 2006-10-13

> BO16767.3prime
ATGGTCTAGAAAGCTTGCTTTATCCTCACACCACTCGTTCTCCTTGCGCA
CCTGTTCCTCCTCCTGTGGCAGAAAGTCATTCTGGATGGCGAAGGTGTCG
CGAATAGCCTGCGGCGACTTGCCCTTGATCATATTGGCCACCGTCTTGCA
GGTGACGTCGAGCAGACCCTGGATATTCAGGTAGTTTGCCGCGAGGATCA
GTTCGAACAGCGTGCCCTGGTCGACTTTGAGAAAGTCAGCGTCCCAGGAT
GAGATGTCATCAGTGCGCTTCTCCTTGTTCTCAACCTCTTCGGTAACCAC
AGGATCGTCCTTGTGATAGGTGGCCCAGTGGAGCACTTTCTTCAGGATCA
GCGAGTTGACATTCGGCAACGGCAGCACACTGTTGTCGCTCTCATCGCCC
AAATCCTCTATTGCAATGCGAATCGTTTCCGAGCACTTGGCGATCTCCTG
ATCCGTGTCAAAGATCTCCTTGTCCGCAGACTCCAGCCGAATGATGGGCA
TGTCGACTGATAACT

BO16767.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 16:32:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG8881-PA 486 skpB-RA 1..483 501..19 2415 100 Minus
CG16983-PE 489 skpA-RE 442..482 63..23 155 95.1 Minus
CG16983-PF 489 skpA-RF 442..482 63..23 155 95.1 Minus
CG16983-PC 489 skpA-RC 442..482 63..23 155 95.1 Minus
CG16983-PB 489 skpA-RB 442..482 63..23 155 95.1 Minus
CG16983-PG 489 skpA-RG 442..482 63..23 155 95.1 Minus
CG16983-PD 489 skpA-RD 442..482 63..23 155 95.1 Minus
CG16983-PA 489 skpA-RA 442..482 63..23 155 95.1 Minus
CG16983-PH 489 skpA-RH 442..482 63..23 155 95.1 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:50:36
Subject Length Description Subject Range Query Range Score Percent Strand
SkpB-RA 877 CG8881-RA 248..730 501..19 2415 100 Minus
SkpA-RI 826 CG16983-RI 167..518 374..23 440 75.7 Minus
SkpA-RH 1544 CG16983-RH 885..1236 374..23 440 75.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:50:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12139442..12139924 19..501 2415 100 Plus
X 23542271 X 657240..657591 374..23 440 75 Minus
X 23542271 X 19816391..19816567 260..84 210 74.6 Minus
2R 25286936 2R 23458303..23458401 121..219 195 79.8 Plus
Blast to na_te.dros performed on 2015-02-12 10:50:34 has no hits.

BO16767.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:04 Download gff for BO16767.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8881-PA 1..486 16..501 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:40:27 Download gff for BO16767.3prime
Subject Subject Range Query Range Percent Splice Strand
skpB-RA 240..734 15..509 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:27:02 Download gff for BO16767.3prime
Subject Subject Range Query Range Percent Splice Strand
SkpB-RA 240..734 15..509 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:27:02 Download gff for BO16767.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 12139438..12139924 15..501 99 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:40:27 Download gff for BO16767.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8026943..8027429 15..501 99 <- Plus

BO16767.5prime Sequence

515 bp (515 high quality bases) assembled on 2006-10-13

> BO16767.5prime
GAAGTTATCAGTCGACATGCCCATCATTCGGCTGGAGTCTGCGGACAAGG
AGATCTTTGACACGGATCAGGAGATCGCCAAGTGCTCGGAAACGATTCGC
ATTGCAATAGAGGATTTGGGCGATGAGAGCGACAACAGTGTGCTGCCGTT
GCCGAATGTCAACTCGCTGATCCTGAAGAAAGTGCTCCACTGGGCCACCT
ATCACAAGGACGATCCTGTGGTTACCGAAGAGGTTGAGAACAAGGAGAAG
CGCACTGATGACATCTCATCCTGGGACGCTGACTTTCTCAAAGTCGACCA
GGGCACGCTGTTCGAACTGATCCTCGCGGCAAACTACCTGAATATCCAGG
GTCTGCTCGACGTCACCTGCAAGACGGTGGCCAATATGATCAAGGGCAAG
TCGCCGCAGGCTATTCGCGACACCTTCGCCATCCAGAATGACTTTCTGCC
ACAGGAGGAGGAACAGGTGCGCAAGGAGAACGAGTGGTGTGAGGATAAAG
CAAGCTTTCTAGACC

BO16767.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 16:32:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG8881-PA 486 skpB-RA 1..483 17..499 2415 100 Plus
CG16983-PE 489 skpA-RE 442..482 455..495 155 95.1 Plus
CG16983-PF 489 skpA-RF 442..482 455..495 155 95.1 Plus
CG16983-PC 489 skpA-RC 442..482 455..495 155 95.1 Plus
CG16983-PB 489 skpA-RB 442..482 455..495 155 95.1 Plus
CG16983-PG 489 skpA-RG 442..482 455..495 155 95.1 Plus
CG16983-PD 489 skpA-RD 442..482 455..495 155 95.1 Plus
CG16983-PA 489 skpA-RA 442..482 455..495 155 95.1 Plus
CG16983-PH 489 skpA-RH 442..482 455..495 155 95.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:14:11
Subject Length Description Subject Range Query Range Score Percent Strand
SkpB-RA 877 CG8881-RA 248..730 17..499 2415 100 Plus
SkpA-RI 826 CG16983-RI 167..518 144..495 440 75.7 Plus
SkpA-RH 1544 CG16983-RH 885..1236 144..495 440 75.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 23:14:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12139442..12139924 499..17 2415 100 Minus
X 23542271 X 657240..657591 144..495 440 75 Plus
X 23542271 X 19816391..19816567 258..434 210 74.6 Plus
2R 25286936 2R 23458303..23458401 397..299 195 79.8 Minus
Blast to na_te.dros performed on 2015-02-10 23:14:07 has no hits.

BO16767.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:06 Download gff for BO16767.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8881-PA 1..486 17..502 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 08:03:18 Download gff for BO16767.5prime
Subject Subject Range Query Range Percent Splice Strand
skpB-RA 240..734 9..503 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 00:29:26 Download gff for BO16767.5prime
Subject Subject Range Query Range Percent Splice Strand
SkpB-RA 240..734 9..503 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 00:29:26 Download gff for BO16767.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 12139438..12139924 17..503 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 08:03:18 Download gff for BO16767.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8026943..8027429 17..503 99 <- Minus

BO16767.complete Sequence

517 bp assembled on 2007-10-17

GenBank Submission: FJ633908

> BO16767.complete
GAAGTTATCAGTCGACATGCCCATCATTCGGCTGGAGTCTGCGGACAAGG
AGATCTTTGACACGGATCAGGAGATCGCCAAGTGCTCGGAAACGATTCGC
ATTGCAATAGAGGATTTGGGCGATGAGAGCGACAACAGTGTGCTGCCGTT
GCCGAATGTCAACTCGCTGATCCTGAAGAAAGTGCTCCACTGGGCCACCT
ATCACAAGGACGATCCTGTGGTTACCGAAGAGGTTGAGAACAAGGAGAAG
CGCACTGATGACATCTCATCCTGGGACGCTGACTTTCTCAAAGTCGACCA
GGGCACGCTGTTCGAACTGATCCTCGCGGCAAACTACCTGAATATCCAGG
GTCTGCTCGACGTCACCTGCAAGACGGTGGCCAATATGATCAAGGGCAAG
TCGCCGCAGGCTATTCGCGACACCTTCGCCATCCAGAATGACTTTCTGCC
ACAGGAGGAGGAACAGGTGCGCAAGGAGAACGAGTGGTGTGAGGATAAAG
CAAGCTTTCTAGACCAT

BO16767.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
SkpB-RA 486 CG8881-PA 1..483 17..499 2415 100 Plus
SkpA-RI 489 CG16983-PI 131..482 144..495 440 75 Plus
SkpA-RH 489 CG16983-PH 131..482 144..495 440 75 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
SkpB-RA 877 CG8881-RA 248..730 17..499 2415 100 Plus
SkpA-RI 826 CG16983-RI 167..518 144..495 440 75 Plus
SkpA-RH 1544 CG16983-RH 885..1236 144..495 440 75 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:00:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12139442..12139924 499..17 2415 100 Minus
X 23542271 X 657240..657591 144..495 440 75 Plus
X 23542271 X 19816391..19816567 258..434 210 74.6 Plus
2R 25286936 2R 23458303..23458401 397..299 195 79.8 Minus
Blast to na_te.dros performed on 2014-11-27 08:00:49 has no hits.

BO16767.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:03:16 Download gff for BO16767.complete
Subject Subject Range Query Range Percent Splice Strand
skpB-RA 1..486 17..502 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:16:53 Download gff for BO16767.complete
Subject Subject Range Query Range Percent Splice Strand
skpB-RA 73..567 9..503 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:07:14 Download gff for BO16767.complete
Subject Subject Range Query Range Percent Splice Strand
skpB-RA 248..730 17..501 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:41:49 Download gff for BO16767.complete
Subject Subject Range Query Range Percent Splice Strand
skpB-RA 81..563 17..501 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:09:17 Download gff for BO16767.complete
Subject Subject Range Query Range Percent Splice Strand
SkpB-RA 248..730 17..501 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:09:17 Download gff for BO16767.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12139439..12139924 17..501 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:07:14 Download gff for BO16767.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8026944..8027429 17..501 99   Minus

BO16767.pep Sequence

Translation from 16 to 517

> BO16767.pep
MPIIRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNS
LILKKVLHWATYHKDDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFE
LILAANYLNIQGLLDVTCKTVANMIKGKSPQAIRDTFAIQNDFLPQEEEQ
VRKENEWCEDKASFLDH

BO16767.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:28:14
Subject Length Description Subject Range Query Range Score Percent Strand
SkpB-PA 161 CG8881-PA 1..161 1..161 835 100 Plus
SkpA-PI 162 CG16983-PI 1..162 1..161 622 73.5 Plus
SkpA-PH 162 CG16983-PH 1..162 1..161 622 73.5 Plus
SkpA-PA 162 CG16983-PA 1..162 1..161 622 73.5 Plus
SkpA-PD 162 CG16983-PD 1..162 1..161 622 73.5 Plus