Clone BO16775 Report

Search the DGRC for BO16775

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:167
Well:75
Vector:pDNR-Dual
Associated Gene/TranscriptCG4101-RA
Protein status:BO16775.pep: validated full length
Sequenced Size:295

Clone Sequence Records

BO16775.3prime Sequence

293 bp (293 high quality bases) assembled on 2006-10-13

> BO16775.3prime
ATGGTCTAGAAAGCTTGCTCGTCGCTTCTTCTTCTCCAGCTTACGAATCT
TGTGCAGGCGCGTCCGGACCGGCTCGCCCTCCCGCTCCGTCACTTCGCCG
GACTCCGGATTACTTTGGCCATCCGGGTTATTCTCCATCAATACTGCGGC
CGAAATGCAAACGAACTGGAAGAGAGCACCCACATAAAGCCCGTATCGGA
TTAGCAAGCTGAAGATGTCCTCGTCGCCGTACTTGTCCAGGGCTGCGGCG
GCGCCCAGACTGTCCGCGGAAGCCGACATGTCGACTGATAACT

BO16775.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 16:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG4101-PA 264 CG4101-RA 1..261 279..19 1305 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:10:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG4101-RA 465 CG4101-RA 91..351 279..19 1305 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:10:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16612576..16612836 279..19 1305 100 Minus
Blast to na_te.dros performed on 2015-02-11 17:10:22 has no hits.

BO16775.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:15 Download gff for BO16775.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4101-PA 1..264 18..279 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 10:18:54 Download gff for BO16775.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4101-RA 86..351 19..287 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:02:00 Download gff for BO16775.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4101-RA 86..351 19..287 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:02:00 Download gff for BO16775.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 16612571..16612836 19..287 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 10:18:54 Download gff for BO16775.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16605671..16605936 19..287 98   Minus

BO16775.5prime Sequence

293 bp (293 high quality bases) assembled on 2006-10-13

> BO16775.5prime
GAAGTTATCAGTCGACATGTCGGCTTCCGCGGACAGTCTGGGCGCCGCCG
CAGCCCTGGACAAGTACGGCGACGAGGACATCTTCAGCTTGCTAATCCGA
TACGGGCTTTATGTGGGTGCTCTCTTCCAGTTCGTTTGCATTTCGGCCGC
AGTATTGATGGAGAATAACCCGGATGGCCAAAGTAATCCGGAGTCCGGCG
AAGTGACGGAGCGGGAGGGCGAGCCGGTCCGGACGCGCCTGCACAAGATT
CGTAAGCTGGAGAAGAAGAAGCGACGAGCAAGCTTTCTAGACC

BO16775.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 16:33:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG4101-PA 264 CG4101-RA 1..261 17..277 1305 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-31 09:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG4101-RA 465 CG4101-RA 91..351 17..277 1305 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-01-31 09:54:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16612576..16612836 17..277 1305 100 Plus
Blast to na_te.dros performed on 2015-01-31 09:54:32 has no hits.

BO16775.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:17 Download gff for BO16775.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4101-PA 1..264 17..278 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 23:29:44 Download gff for BO16775.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4101-RA 86..351 9..277 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-31 12:39:53 Download gff for BO16775.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4101-RA 86..351 9..277 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-31 12:39:53 Download gff for BO16775.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 16612571..16612836 9..277 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 23:29:44 Download gff for BO16775.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16605671..16605936 9..277 98   Plus

BO16775.complete Sequence

295 bp assembled on 2007-10-17

GenBank Submission: FJ633912

> BO16775.complete
GAAGTTATCAGTCGACATGTCGGCTTCCGCGGACAGTCTGGGCGCCGCCG
CAGCCCTGGACAAGTACGGCGACGAGGACATCTTCAGCTTGCTAATCCGA
TACGGGCTTTATGTGGGTGCTCTCTTCCAGTTCGTTTGCATTTCGGCCGC
AGTATTGATGGAGAATAACCCGGATGGCCAAAGTAATCCGGAGTCCGGCG
AAGTGACGGAGCGGGAGGGCGAGCCGGTCCGGACGCGCCTGCACAAGATT
CGTAAGCTGGAGAAGAAGAAGCGACGAGCAAGCTTTCTAGACCAT

BO16775.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:05:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG4101-RA 264 CG4101-PA 1..261 17..277 1305 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:05:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG4101-RA 465 CG4101-RA 91..351 17..277 1305 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:05:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16612576..16612836 17..277 1305 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:05:26 has no hits.

BO16775.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:03:17 Download gff for BO16775.complete
Subject Subject Range Query Range Percent Splice Strand
CG4101-RA 1..264 17..278 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:16:55 Download gff for BO16775.complete
Subject Subject Range Query Range Percent Splice Strand
CG4101-RA 86..351 9..277 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:04:49 Download gff for BO16775.complete
Subject Subject Range Query Range Percent Splice Strand
CG4101-RA 91..351 17..279 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:36:18 Download gff for BO16775.complete
Subject Subject Range Query Range Percent Splice Strand
CG4101-RA 91..351 17..279 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:02:41 Download gff for BO16775.complete
Subject Subject Range Query Range Percent Splice Strand
CG4101-RA 91..351 17..279 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:02:41 Download gff for BO16775.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16612576..16612836 17..279 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:04:49 Download gff for BO16775.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16605676..16605936 17..279 99   Plus

BO16775.pep Sequence

Translation from 16 to 295

> BO16775.pep
MSASADSLGAAAALDKYGDEDIFSLLIRYGLYVGALFQFVCISAAVLMEN
NPDGQSNPESGEVTEREGEPVRTRLHKIRKLEKKKRRASFLDH

BO16775.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:34:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG4101-PA 87 CG4101-PA 1..87 1..87 438 100 Plus