Clone Sequence Records
BO16777.3prime Sequence
224 bp (224 high quality bases) assembled on 2006-10-13
> BO16777.3prime
ATGGTCTAGAAAGCTTGCGTAAATGGGCTCCGGCTTCTGGGTGAGCAGCA
GTCCAAAGCGCTTCTTGATGGTCAGCCTCTGGCGGGAGTACTTATCCTCC
GGTGAAAAACGTGCTGGATGAGCAGATAGTGTGGGACGACCATCCTCGGT
GCGTTTCTTCAGGGTGTAAACGCGATCGCCGTTTTCGTTAATTGTGTACA
TCAGATACATGTCGACTGATAACT
BO16777.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7637-PA | 195 | CG7637-RA | 1..192 | 210..19 | 960 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:21:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7637-RA | 316 | CG7637-RA | 61..252 | 210..19 | 960 | 100 | Minus |
CG12935-RB | 918 | CG12935-RB | 883..918 | 19..54 | 180 | 100 | Plus |
CG12935-RA | 1200 | CG12935-RA | 1165..1200 | 19..54 | 180 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:21:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 10810620..10810759 | 19..158 | 700 | 100 | Plus |
2R | 25286936 | 2R | 10810823..10810876 | 157..210 | 270 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-10 21:21:45 has no hits.
BO16777.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:19 Download gff for
BO16777.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7637-PA | 1..195 | 15..210 | 98 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 18:05:33 Download gff for
BO16777.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7637-RA | 61..257 | 13..210 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:41:01 Download gff for
BO16777.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7637-RA | 61..257 | 13..210 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:41:01 Download gff for
BO16777.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 10810615..10810757 | 13..156 | 98 | <- | Plus |
2R | 10810823..10810876 | 157..210 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 18:05:33 Download gff for
BO16777.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 6698120..6698262 | 13..156 | 98 | <- | Plus |
arm_2R | 6698328..6698381 | 157..210 | 100 | | Plus |
BO16777.5prime Sequence
224 bp (224 high quality bases) assembled on 2006-10-13
> BO16777.5prime
GAAGTTATCAGTCGACATGTATCTGATGTACACAATTAACGAAAACGGCG
ATCGCGTTTACACCCTGAAGAAACGCACCGAGGATGGTCGTCCCACACTA
TCTGCTCATCCAGCACGTTTTTCACCGGAGGATAAGTACTCCCGCCAGAG
GCTGACCATCAAGAAGCGCTTTGGACTGCTGCTCACCCAGAAGCCGGAGC
CCATTTACGCAAGCTTTCTAGACC
BO16777.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7637-PA | 195 | CG7637-RA | 1..192 | 17..208 | 960 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:53:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7637-RA | 316 | CG7637-RA | 61..252 | 17..208 | 960 | 100 | Plus |
CG12935-RB | 918 | CG12935-RB | 883..918 | 208..173 | 180 | 100 | Minus |
CG12935-RA | 1200 | CG12935-RA | 1165..1200 | 208..173 | 180 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:53:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 10810620..10810759 | 208..69 | 700 | 100 | Minus |
2R | 25286936 | 2R | 10810823..10810876 | 70..17 | 270 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-10 20:53:04 has no hits.
BO16777.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:19 Download gff for
BO16777.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7637-PA | 1..195 | 17..212 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 06:22:06 Download gff for
BO16777.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7637-RA | 61..257 | 17..214 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:29:12 Download gff for
BO16777.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7637-RA | 61..257 | 17..214 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:29:12 Download gff for
BO16777.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 10810615..10810757 | 71..214 | 98 | <- | Minus |
2R | 10810823..10810876 | 17..70 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 06:22:06 Download gff for
BO16777.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 6698120..6698262 | 71..214 | 98 | <- | Minus |
arm_2R | 6698328..6698381 | 17..70 | 100 | | Minus |
BO16777.complete Sequence
226 bp assembled on 2006-10-11
GenBank Submission: FJ633913
> BO16777.complete
GAAGTTATCAGTCGACATGTATCTGATGTACACAATTAACGAAAACGGCG
ATCGCGTTTACACCCTGAAGAAACGCACCGAGGATGGTCGTCCCACACTA
TCTGCTCATCCAGCACGTTTTTCACCGGAGGATAAGTACTCCCGCCAGAG
GCTGACCATCAAGAAGCGCTTTGGACTGCTGCTCACCCAGAAGCCGGAGC
CCATTTACGCAAGCTTTCTAGACCAT
BO16777.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:56:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7637-RA | 195 | CG7637-PA | 1..192 | 17..208 | 960 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:56:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7637-RA | 316 | CG7637-RA | 61..252 | 17..208 | 960 | 100 | Plus |
CG12935-RB | 918 | CG12935-RB | 883..918 | 208..173 | 180 | 100 | Minus |
CG12935-RA | 1200 | CG12935-RA | 1165..1200 | 208..173 | 180 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:56:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 10810620..10810759 | 208..69 | 700 | 100 | Minus |
2R | 25286936 | 2R | 10810823..10810876 | 70..17 | 270 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 00:56:39 has no hits.
BO16777.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:38 Download gff for
BO16777.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7637-RA | 1..195 | 17..212 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:19:06 Download gff for
BO16777.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7637-RA | 15..211 | 17..214 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:39:26 Download gff for
BO16777.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7637-RA | 61..252 | 17..210 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:39 Download gff for
BO16777.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7637-RA | 15..211 | 17..214 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:14:19 Download gff for
BO16777.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7637-RA | 61..252 | 17..210 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:14:19 Download gff for
BO16777.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 10810618..10810757 | 71..210 | 98 | <- | Minus |
2R | 10810823..10810876 | 17..70 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:39:26 Download gff for
BO16777.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 6698123..6698262 | 71..210 | 98 | <- | Minus |
arm_2R | 6698328..6698381 | 17..70 | 100 | | Minus |
BO16777.pep Sequence
Translation from 16 to 226
> BO16777.pep
MYLMYTINENGDRVYTLKKRTEDGRPTLSAHPARFSPEDKYSRQRLTIKK
RFGLLLTQKPEPIYASFLDH
BO16777.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:22:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7637-PA | 64 | CG7637-PA | 1..64 | 1..64 | 337 | 100 | Plus |