Clone BO16777 Report

Search the DGRC for BO16777

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:167
Well:77
Vector:pDNR-Dual
Associated Gene/TranscriptCG7637-RA
Protein status:BO16777.pep: validated full length
Sequenced Size:226

Clone Sequence Records

BO16777.3prime Sequence

224 bp (224 high quality bases) assembled on 2006-10-13

> BO16777.3prime
ATGGTCTAGAAAGCTTGCGTAAATGGGCTCCGGCTTCTGGGTGAGCAGCA
GTCCAAAGCGCTTCTTGATGGTCAGCCTCTGGCGGGAGTACTTATCCTCC
GGTGAAAAACGTGCTGGATGAGCAGATAGTGTGGGACGACCATCCTCGGT
GCGTTTCTTCAGGGTGTAAACGCGATCGCCGTTTTCGTTAATTGTGTACA
TCAGATACATGTCGACTGATAACT

BO16777.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG7637-PA 195 CG7637-RA 1..192 210..19 960 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:21:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG7637-RA 316 CG7637-RA 61..252 210..19 960 100 Minus
CG12935-RB 918 CG12935-RB 883..918 19..54 180 100 Plus
CG12935-RA 1200 CG12935-RA 1165..1200 19..54 180 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:21:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10810620..10810759 19..158 700 100 Plus
2R 25286936 2R 10810823..10810876 157..210 270 100 Plus
Blast to na_te.dros performed on 2015-02-10 21:21:45 has no hits.

BO16777.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:19 Download gff for BO16777.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7637-PA 1..195 15..210 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 18:05:33 Download gff for BO16777.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 61..257 13..210 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:41:01 Download gff for BO16777.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 61..257 13..210 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:41:01 Download gff for BO16777.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 10810615..10810757 13..156 98 <- Plus
2R 10810823..10810876 157..210 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 18:05:33 Download gff for BO16777.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6698120..6698262 13..156 98 <- Plus
arm_2R 6698328..6698381 157..210 100   Plus

BO16777.5prime Sequence

224 bp (224 high quality bases) assembled on 2006-10-13

> BO16777.5prime
GAAGTTATCAGTCGACATGTATCTGATGTACACAATTAACGAAAACGGCG
ATCGCGTTTACACCCTGAAGAAACGCACCGAGGATGGTCGTCCCACACTA
TCTGCTCATCCAGCACGTTTTTCACCGGAGGATAAGTACTCCCGCCAGAG
GCTGACCATCAAGAAGCGCTTTGGACTGCTGCTCACCCAGAAGCCGGAGC
CCATTTACGCAAGCTTTCTAGACC

BO16777.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG7637-PA 195 CG7637-RA 1..192 17..208 960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:53:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG7637-RA 316 CG7637-RA 61..252 17..208 960 100 Plus
CG12935-RB 918 CG12935-RB 883..918 208..173 180 100 Minus
CG12935-RA 1200 CG12935-RA 1165..1200 208..173 180 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10810620..10810759 208..69 700 100 Minus
2R 25286936 2R 10810823..10810876 70..17 270 100 Minus
Blast to na_te.dros performed on 2015-02-10 20:53:04 has no hits.

BO16777.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:19 Download gff for BO16777.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7637-PA 1..195 17..212 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 06:22:06 Download gff for BO16777.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 61..257 17..214 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:29:12 Download gff for BO16777.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 61..257 17..214 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:29:12 Download gff for BO16777.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 10810615..10810757 71..214 98 <- Minus
2R 10810823..10810876 17..70 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 06:22:06 Download gff for BO16777.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6698120..6698262 71..214 98 <- Minus
arm_2R 6698328..6698381 17..70 100   Minus

BO16777.complete Sequence

226 bp assembled on 2006-10-11

GenBank Submission: FJ633913

> BO16777.complete
GAAGTTATCAGTCGACATGTATCTGATGTACACAATTAACGAAAACGGCG
ATCGCGTTTACACCCTGAAGAAACGCACCGAGGATGGTCGTCCCACACTA
TCTGCTCATCCAGCACGTTTTTCACCGGAGGATAAGTACTCCCGCCAGAG
GCTGACCATCAAGAAGCGCTTTGGACTGCTGCTCACCCAGAAGCCGGAGC
CCATTTACGCAAGCTTTCTAGACCAT

BO16777.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:56:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG7637-RA 195 CG7637-PA 1..192 17..208 960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:56:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG7637-RA 316 CG7637-RA 61..252 17..208 960 100 Plus
CG12935-RB 918 CG12935-RB 883..918 208..173 180 100 Minus
CG12935-RA 1200 CG12935-RA 1165..1200 208..173 180 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:56:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10810620..10810759 208..69 700 100 Minus
2R 25286936 2R 10810823..10810876 70..17 270 100 Minus
Blast to na_te.dros performed on 2014-11-27 00:56:39 has no hits.

BO16777.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:38 Download gff for BO16777.complete
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 1..195 17..212 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:19:06 Download gff for BO16777.complete
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 15..211 17..214 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:39:26 Download gff for BO16777.complete
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 61..252 17..210 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:39 Download gff for BO16777.complete
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 15..211 17..214 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:14:19 Download gff for BO16777.complete
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 61..252 17..210 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:14:19 Download gff for BO16777.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10810618..10810757 71..210 98 <- Minus
2R 10810823..10810876 17..70 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:39:26 Download gff for BO16777.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6698123..6698262 71..210 98 <- Minus
arm_2R 6698328..6698381 17..70 100   Minus

BO16777.pep Sequence

Translation from 16 to 226

> BO16777.pep
MYLMYTINENGDRVYTLKKRTEDGRPTLSAHPARFSPEDKYSRQRLTIKK
RFGLLLTQKPEPIYASFLDH

BO16777.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG7637-PA 64 CG7637-PA 1..64 1..64 337 100 Plus