Clone BO16782 Report

Search the DGRC for BO16782

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:167
Well:82
Vector:pDNR-Dual
Associated Gene/Transcripte(y)2b-RA
Protein status:BO16782.pep: validated full length
Sequenced Size:319

Clone Sequence Records

BO16782.3prime Sequence

317 bp (317 high quality bases) assembled on 2006-10-13

> BO16782.3prime
ATGGTCTAGAAAGCTTGCCTTATCGAGGGCGGCGTGCACGCGCAGCATCA
TCTCATTTTTGACGACTTCAGGCACCAAAGCGCGAGCTTGCGGGACTATT
TGGGCAGCCAGTTGGTCGCGGTTTATATTGTCCACTCCGCGCTCCATGAT
GATGTTTCGTATCATTTCCTTAATGTCCTTGTGCCATCCGCACTCCACAA
GACGCGTGTGCAGCAGTTCCTTCAGGGCGGCCTTATCTTGACTGCGTAAC
GTAGGCTTATATCCAGGATCGGGATCGGTTCCCGTTTCCTTGTTTATTGT
CATGTCGACTGATAACT

BO16782.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG14612-PA 288 CG14612-RA 1..285 303..19 1425 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:08:05
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)2b-RB 662 CG14612-RB 189..474 304..19 1430 100 Minus
e(y)2b-RA 559 CG14612-RA 86..371 304..19 1430 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 09:08:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7094263..7094402 226..87 700 100 Minus
3R 32079331 3R 7094123..7094200 304..227 390 100 Minus
3R 32079331 3R 7094471..7094539 87..19 345 100 Minus
Blast to na_te.dros performed on 2015-02-11 09:08:04 has no hits.

BO16782.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:26 Download gff for BO16782.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14612-PA 1..288 18..303 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 17:00:55 Download gff for BO16782.3prime
Subject Subject Range Query Range Percent Splice Strand
e(y)2b-RA 80..371 19..308 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:55:08 Download gff for BO16782.3prime
Subject Subject Range Query Range Percent Splice Strand
e(y)2b-RA 80..371 19..308 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 10:55:08 Download gff for BO16782.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 7094117..7094200 227..308 97 -> Minus
3R 7094263..7094401 88..226 100 -> Minus
3R 7094471..7094539 19..87 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 17:00:55 Download gff for BO16782.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2919839..2919922 227..308 97 -> Minus
arm_3R 2919985..2920123 88..226 100 -> Minus
arm_3R 2920193..2920261 19..87 100   Minus

BO16782.5prime Sequence

317 bp (317 high quality bases) assembled on 2006-10-13

> BO16782.5prime
GAAGTTATCCGTCGACATGACAATAAACAAGGAAACGGGAACCGATCCCG
ATCCTGGATATAAGCCTACGTTACGCAGTCAAGATAAGGCCGCCCTGAAG
GAACTGCTGCACACGCGTCTTGTGGAGTGCGGATGGCACAAGGACATTAA
GGAAATGATACGAAACATCATCATGGAGCGCGGAGTGGACAATATAAACC
GCGACCAACTGGCTGCCCAAATAGTCCCGCAAGCTCGCGCTTTGGTGCCT
GAAGTCGTCAAAAATGAGATGATGCTGCGCGTGCACGCCGCCCTCGATAA
GGCAAGCTTTCTAGACC

BO16782.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG14612-PA 288 CG14612-RA 1..285 17..301 1425 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-30 17:46:30
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)2b-RB 662 CG14612-RB 189..474 16..301 1430 100 Plus
e(y)2b-RA 559 CG14612-RA 86..371 16..301 1430 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-01-30 17:46:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7094263..7094402 94..233 700 100 Plus
3R 32079331 3R 7094123..7094200 16..93 390 100 Plus
3R 32079331 3R 7094471..7094539 233..301 345 100 Plus
Blast to na_te.dros performed on 2015-01-30 17:46:26 has no hits.

BO16782.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:27 Download gff for BO16782.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14612-PA 1..288 17..302 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 18:50:06 Download gff for BO16782.5prime
Subject Subject Range Query Range Percent Splice Strand
e(y)2b-RA 80..371 12..301 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-30 20:04:58 Download gff for BO16782.5prime
Subject Subject Range Query Range Percent Splice Strand
e(y)2b-RA 80..371 12..301 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-30 20:04:58 Download gff for BO16782.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 7094117..7094200 12..93 97 -> Plus
3R 7094263..7094401 94..232 100 -> Plus
3R 7094471..7094539 233..301 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 18:50:06 Download gff for BO16782.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2919839..2919922 12..93 97 -> Plus
arm_3R 2919985..2920123 94..232 100 -> Plus
arm_3R 2920193..2920261 233..301 100   Plus

BO16782.complete Sequence

319 bp assembled on 2006-10-11

GenBank Submission: FJ633916

> BO16782.complete
GAAGTTATCAGTCGACATGACAATAAACAAGGAAACGGGAACCGATCCCG
ATCCTGGATATAAGCCTACGTTACGCAGTCAAGATAAGGCCGCCCTGAAG
GAACTGCTGCACACGCGTCTTGTGGAGTGCGGATGGCACAAGGACATTAA
GGAAATGATACGAAACATCATCATGGAGCGCGGAGTGGACAATATAAACC
GCGACCAACTGGCTGCCCAAATAGTCCCGCAAGCTCGCGCTTTGGTGCCT
GAAGTCGTCAAAAATGAGATGATGCTGCGCGTGCACGCCGCCCTCGATAA
GGCAAGCTTTCTAGACCAT

BO16782.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:30:20
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)2b-RB 288 CG14612-PB 1..285 17..301 1425 100 Plus
e(y)2b-RA 288 CG14612-PA 1..285 17..301 1425 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:30:21
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)2b-RB 662 CG14612-RB 189..474 16..301 1430 100 Plus
e(y)2b-RA 559 CG14612-RA 86..371 16..301 1430 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7094263..7094402 94..233 700 100 Plus
3R 32079331 3R 7094123..7094200 16..93 390 100 Plus
3R 32079331 3R 7094471..7094539 233..301 345 100 Plus
Blast to na_te.dros performed on 2014-11-27 15:30:19 has no hits.

BO16782.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:05:16 Download gff for BO16782.complete
Subject Subject Range Query Range Percent Splice Strand
CG14612-RA 1..288 17..302 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:20:04 Download gff for BO16782.complete
Subject Subject Range Query Range Percent Splice Strand
CG14612-RA 1..288 17..302 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:47:19 Download gff for BO16782.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)2b-RA 87..371 17..303 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:05:16 Download gff for BO16782.complete
Subject Subject Range Query Range Percent Splice Strand
CG14612-RA 1..288 17..302 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:09:27 Download gff for BO16782.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)2b-RA 87..371 17..303 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:09:27 Download gff for BO16782.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7094124..7094200 17..93 100 -> Plus
3R 7094263..7094401 94..232 100 -> Plus
3R 7094471..7094539 233..303 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:47:19 Download gff for BO16782.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2919846..2919922 17..93 100 -> Plus
arm_3R 2919985..2920123 94..232 100 -> Plus
arm_3R 2920193..2920261 233..303 97   Plus

BO16782.pep Sequence

Translation from 16 to 319

> BO16782.pep
MTINKETGTDPDPGYKPTLRSQDKAALKELLHTRLVECGWHKDIKEMIRN
IIMERGVDNINRDQLAAQIVPQARALVPEVVKNEMMLRVHAALDKASFLD
H

BO16782.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:47:31
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)2b-PB 95 CG14612-PB 1..95 1..95 490 100 Plus
e(y)2b-PA 95 CG14612-PA 1..95 1..95 490 100 Plus
e(y)2-PA 101 CG15191-PA 11..87 18..93 181 41.6 Plus