Clone Sequence Records
BO16782.3prime Sequence
317 bp (317 high quality bases) assembled on 2006-10-13
> BO16782.3prime
ATGGTCTAGAAAGCTTGCCTTATCGAGGGCGGCGTGCACGCGCAGCATCA
TCTCATTTTTGACGACTTCAGGCACCAAAGCGCGAGCTTGCGGGACTATT
TGGGCAGCCAGTTGGTCGCGGTTTATATTGTCCACTCCGCGCTCCATGAT
GATGTTTCGTATCATTTCCTTAATGTCCTTGTGCCATCCGCACTCCACAA
GACGCGTGTGCAGCAGTTCCTTCAGGGCGGCCTTATCTTGACTGCGTAAC
GTAGGCTTATATCCAGGATCGGGATCGGTTCCCGTTTCCTTGTTTATTGT
CATGTCGACTGATAACT
BO16782.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14612-PA | 288 | CG14612-RA | 1..285 | 303..19 | 1425 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:08:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
e(y)2b-RB | 662 | CG14612-RB | 189..474 | 304..19 | 1430 | 100 | Minus |
e(y)2b-RA | 559 | CG14612-RA | 86..371 | 304..19 | 1430 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 09:08:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 7094263..7094402 | 226..87 | 700 | 100 | Minus |
3R | 32079331 | 3R | 7094123..7094200 | 304..227 | 390 | 100 | Minus |
3R | 32079331 | 3R | 7094471..7094539 | 87..19 | 345 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-11 09:08:04 has no hits.
BO16782.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:26 Download gff for
BO16782.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14612-PA | 1..288 | 18..303 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 17:00:55 Download gff for
BO16782.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
e(y)2b-RA | 80..371 | 19..308 | 99 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:55:08 Download gff for
BO16782.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
e(y)2b-RA | 80..371 | 19..308 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 10:55:08 Download gff for
BO16782.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 7094117..7094200 | 227..308 | 97 | -> | Minus |
3R | 7094263..7094401 | 88..226 | 100 | -> | Minus |
3R | 7094471..7094539 | 19..87 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 17:00:55 Download gff for
BO16782.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 2919839..2919922 | 227..308 | 97 | -> | Minus |
arm_3R | 2919985..2920123 | 88..226 | 100 | -> | Minus |
arm_3R | 2920193..2920261 | 19..87 | 100 | | Minus |
BO16782.5prime Sequence
317 bp (317 high quality bases) assembled on 2006-10-13
> BO16782.5prime
GAAGTTATCCGTCGACATGACAATAAACAAGGAAACGGGAACCGATCCCG
ATCCTGGATATAAGCCTACGTTACGCAGTCAAGATAAGGCCGCCCTGAAG
GAACTGCTGCACACGCGTCTTGTGGAGTGCGGATGGCACAAGGACATTAA
GGAAATGATACGAAACATCATCATGGAGCGCGGAGTGGACAATATAAACC
GCGACCAACTGGCTGCCCAAATAGTCCCGCAAGCTCGCGCTTTGGTGCCT
GAAGTCGTCAAAAATGAGATGATGCTGCGCGTGCACGCCGCCCTCGATAA
GGCAAGCTTTCTAGACC
BO16782.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14612-PA | 288 | CG14612-RA | 1..285 | 17..301 | 1425 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-30 17:46:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
e(y)2b-RB | 662 | CG14612-RB | 189..474 | 16..301 | 1430 | 100 | Plus |
e(y)2b-RA | 559 | CG14612-RA | 86..371 | 16..301 | 1430 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-01-30 17:46:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 7094263..7094402 | 94..233 | 700 | 100 | Plus |
3R | 32079331 | 3R | 7094123..7094200 | 16..93 | 390 | 100 | Plus |
3R | 32079331 | 3R | 7094471..7094539 | 233..301 | 345 | 100 | Plus |
Blast to na_te.dros performed on 2015-01-30 17:46:26 has no hits.
BO16782.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:27 Download gff for
BO16782.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14612-PA | 1..288 | 17..302 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 18:50:06 Download gff for
BO16782.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
e(y)2b-RA | 80..371 | 12..301 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-30 20:04:58 Download gff for
BO16782.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
e(y)2b-RA | 80..371 | 12..301 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-30 20:04:58 Download gff for
BO16782.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 7094117..7094200 | 12..93 | 97 | -> | Plus |
3R | 7094263..7094401 | 94..232 | 100 | -> | Plus |
3R | 7094471..7094539 | 233..301 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 18:50:06 Download gff for
BO16782.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 2919839..2919922 | 12..93 | 97 | -> | Plus |
arm_3R | 2919985..2920123 | 94..232 | 100 | -> | Plus |
arm_3R | 2920193..2920261 | 233..301 | 100 | | Plus |
BO16782.complete Sequence
319 bp assembled on 2006-10-11
GenBank Submission: FJ633916
> BO16782.complete
GAAGTTATCAGTCGACATGACAATAAACAAGGAAACGGGAACCGATCCCG
ATCCTGGATATAAGCCTACGTTACGCAGTCAAGATAAGGCCGCCCTGAAG
GAACTGCTGCACACGCGTCTTGTGGAGTGCGGATGGCACAAGGACATTAA
GGAAATGATACGAAACATCATCATGGAGCGCGGAGTGGACAATATAAACC
GCGACCAACTGGCTGCCCAAATAGTCCCGCAAGCTCGCGCTTTGGTGCCT
GAAGTCGTCAAAAATGAGATGATGCTGCGCGTGCACGCCGCCCTCGATAA
GGCAAGCTTTCTAGACCAT
BO16782.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:30:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
e(y)2b-RB | 288 | CG14612-PB | 1..285 | 17..301 | 1425 | 100 | Plus |
e(y)2b-RA | 288 | CG14612-PA | 1..285 | 17..301 | 1425 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:30:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
e(y)2b-RB | 662 | CG14612-RB | 189..474 | 16..301 | 1430 | 100 | Plus |
e(y)2b-RA | 559 | CG14612-RA | 86..371 | 16..301 | 1430 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:30:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 7094263..7094402 | 94..233 | 700 | 100 | Plus |
3R | 32079331 | 3R | 7094123..7094200 | 16..93 | 390 | 100 | Plus |
3R | 32079331 | 3R | 7094471..7094539 | 233..301 | 345 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 15:30:19 has no hits.
BO16782.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:05:16 Download gff for
BO16782.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14612-RA | 1..288 | 17..302 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:20:04 Download gff for
BO16782.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14612-RA | 1..288 | 17..302 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:47:19 Download gff for
BO16782.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
e(y)2b-RA | 87..371 | 17..303 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:05:16 Download gff for
BO16782.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14612-RA | 1..288 | 17..302 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:09:27 Download gff for
BO16782.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
e(y)2b-RA | 87..371 | 17..303 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:09:27 Download gff for
BO16782.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 7094124..7094200 | 17..93 | 100 | -> | Plus |
3R | 7094263..7094401 | 94..232 | 100 | -> | Plus |
3R | 7094471..7094539 | 233..303 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:47:19 Download gff for
BO16782.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 2919846..2919922 | 17..93 | 100 | -> | Plus |
arm_3R | 2919985..2920123 | 94..232 | 100 | -> | Plus |
arm_3R | 2920193..2920261 | 233..303 | 97 | | Plus |
BO16782.pep Sequence
Translation from 16 to 319
> BO16782.pep
MTINKETGTDPDPGYKPTLRSQDKAALKELLHTRLVECGWHKDIKEMIRN
IIMERGVDNINRDQLAAQIVPQARALVPEVVKNEMMLRVHAALDKASFLD
H
BO16782.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:47:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
e(y)2b-PB | 95 | CG14612-PB | 1..95 | 1..95 | 490 | 100 | Plus |
e(y)2b-PA | 95 | CG14612-PA | 1..95 | 1..95 | 490 | 100 | Plus |
e(y)2-PA | 101 | CG15191-PA | 11..87 | 18..93 | 181 | 41.6 | Plus |