Clone BO16785 Report

Search the DGRC for BO16785

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:167
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptCG11666-RA
Protein status:BO16785.pep: validated full length
Sequenced Size:322

Clone Sequence Records

BO16785.3prime Sequence

320 bp (320 high quality bases) assembled on 2006-10-13

> BO16785.3prime
ATGGTCTAGAAAGCTTGCAGGATGCATGGCATTTAGGGCGAGTGGAATGG
ACATGGCGGGCTGGACCATTCGCTCACTCTCCATTTCCAATTTACGTTCC
AAGATGTCCTCTCGCCCAATGTCGATGTCTATCGGCTGCCAGTGATGGTA
GCTTTCGATCCTCGAGGACAATGGAAAAGTGCTGCACACGGTCGTCAAAC
TGGAGTTTTTGGTCAGGTCATGGTTGTACTGCTCCTCGCTGCTCGTGGTT
ACCTCGTCGAGATCCTTATCCACATCCTGCGCCTGCAACTGTTGCTTGAC
ATCCATGTCGACTGATAACT

BO16785.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 16:34:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG11666-PA 291 CG11666-RA 1..288 306..19 1440 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-03 06:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG11666-RA 561 CG11666-RA 36..323 306..19 1440 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-03 06:17:48
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20984721..20985008 306..19 1440 100 Minus
Blast to na_te.dros performed on 2015-02-03 06:17:51 has no hits.

BO16785.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:29 Download gff for BO16785.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11666-PA 1..291 15..306 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-09 04:25:53 Download gff for BO16785.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11666-RA 32..326 15..314 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-03 07:35:22 Download gff for BO16785.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11666-RA 32..326 15..314 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-03 07:35:22 Download gff for BO16785.3prime
Subject Subject Range Query Range Percent Splice Strand
X 20984717..20985011 15..314 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-09 04:25:53 Download gff for BO16785.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 20855744..20856038 15..314 98   Minus

BO16785.5prime Sequence

320 bp (320 high quality bases) assembled on 2006-10-13

> BO16785.5prime
GAAGTTATCCGTCGACATGGATGTCAAGCAACAGTTGCAGGCGCAGGATG
TGGATAAGGATCTCGACGAGGTAACCACGAGCAGCGAGGAGCAGTACAAC
CATGACCTGACCAAAAACTCCAGTTTGACGACCGTGTGCAGCACTTTTCC
ATTGTCCTCGAGGATCGAAAGCTACCATCACTGGCAGCCGATAGACATCG
ACATTGGGCGAGAGGACATCTTGGAACGTAAATTGGAAATGGAGAGTGAG
CGAATGGTCCAGCCCGCCATGTCCATTCCACTCGCCCTAAATGCCATGCA
TCCTGCAAGCTTTCTAGACC

BO16785.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 16:34:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG11666-PA 291 CG11666-RA 1..288 17..304 1440 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG11666-RA 561 CG11666-RA 36..323 17..304 1440 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 13:09:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20984721..20985008 17..304 1440 100 Plus
Blast to na_te.dros performed on 2015-02-06 13:09:10 has no hits.

BO16785.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:29 Download gff for BO16785.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11666-PA 1..291 17..308 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 04:17:24 Download gff for BO16785.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11666-RA 36..326 17..308 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:45:35 Download gff for BO16785.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11666-RA 36..326 17..308 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:45:35 Download gff for BO16785.5prime
Subject Subject Range Query Range Percent Splice Strand
X 20984721..20985011 17..308 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 04:17:24 Download gff for BO16785.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 20855748..20856038 17..308 99   Plus

BO16785.complete Sequence

322 bp assembled on 2007-10-17

GenBank Submission: FJ633918

> BO16785.complete
GAAGTTATCAGTCGACATGGATGTCAAGCAACAGTTGCAGGCGCAGGATG
TGGATAAGGATCTCGACGAGGTAACCACGAGCAGCGAGGAGCAGTACAAC
CATGACCTGACCAAAAACTCCAGTTTGACGACCGTGTGCAGCACTTTTCC
ATTGTCCTCGAGGATCGAAAGCTACCATCACTGGCAGCCGATAGACATCG
ACATTGGGCGAGAGGACATCTTGGAACGTAAATTGGAAATGGAGAGTGAG
CGAATGGTCCAGCCCGCCATGTCCATTCCACTCGCCCTAAATGCCATGCA
TCCTGCAAGCTTTCTAGACCAT

BO16785.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:49:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG11666-RA 291 CG11666-PA 1..288 17..304 1440 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:49:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG11666-RA 561 CG11666-RA 36..323 17..304 1440 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:49:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20984721..20985008 17..304 1440 100 Plus
Blast to na_te.dros performed on 2014-11-27 14:49:03 has no hits.

BO16785.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:03:20 Download gff for BO16785.complete
Subject Subject Range Query Range Percent Splice Strand
CG11666-RA 1..291 17..308 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:16:56 Download gff for BO16785.complete
Subject Subject Range Query Range Percent Splice Strand
CG11666-RA 32..326 9..308 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:52:30 Download gff for BO16785.complete
Subject Subject Range Query Range Percent Splice Strand
CG11666-RA 36..323 17..306 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:45:30 Download gff for BO16785.complete
Subject Subject Range Query Range Percent Splice Strand
CG11666-RA 36..323 17..306 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:19:18 Download gff for BO16785.complete
Subject Subject Range Query Range Percent Splice Strand
CG11666-RA 36..323 17..306 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:19:18 Download gff for BO16785.complete
Subject Subject Range Query Range Percent Splice Strand
X 20984721..20985008 17..306 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:52:30 Download gff for BO16785.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20855748..20856035 17..306 99   Plus

BO16785.pep Sequence

Translation from 16 to 322

> BO16785.pep
MDVKQQLQAQDVDKDLDEVTTSSEEQYNHDLTKNSSLTTVCSTFPLSSRI
ESYHHWQPIDIDIGREDILERKLEMESERMVQPAMSIPLALNAMHPASFL
DH

BO16785.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:28:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG11666-PA 96 CG11666-PA 1..96 1..96 496 100 Plus