Clone Sequence Records
BO16788.3prime Sequence
290 bp (290 high quality bases) assembled on 2006-10-13
> BO16788.3prime
ATGGTCTAGAAAGCTTGCGTTCTTCTCGAGCTTCAGGTCGCCGAGCTTCT
CGTTCAGCGCACTTTCTTCATCCTCCTCAGCTTTGAACATCTCCGGATCG
TATATGACCTTGATGACTAGGGAGCAGCTGGGACAGGTGGCCACCTCCTC
GCCCTCGATTAGCTCCTCCTTGGAGATCTGAAATCGATCGCCGCATGGAC
AGGGATAGTAGTACATCTCCTCCTCCTCGTCGTACTCGAAGTCCTCGATC
TCCACCTCGTCGTGATAGATGCTCATGTCGACTGATAACT
BO16788.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14701-PA | 261 | CG14701-RA | 1..258 | 276..19 | 1290 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:31:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14701-RA | 487 | CG14701-RA | 105..363 | 277..19 | 1295 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:31:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 11232016..11232125 | 277..168 | 550 | 100 | Minus |
3R | 32079331 | 3R | 11232192..11232269 | 170..93 | 390 | 100 | Minus |
3R | 32079331 | 3R | 11232340..11232415 | 94..19 | 380 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-10 17:31:10 has no hits.
BO16788.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:33 Download gff for
BO16788.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14701-PA | 1..261 | 15..276 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:41:22 Download gff for
BO16788.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14701-RA | 102..366 | 15..280 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:57:51 Download gff for
BO16788.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14701-RA | 102..366 | 15..280 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:57:51 Download gff for
BO16788.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 11232013..11232124 | 169..280 | 99 | -> | Minus |
3R | 11232194..11232268 | 94..168 | 100 | -> | Minus |
3R | 11232341..11232424 | 15..93 | 92 | -> | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:41:22 Download gff for
BO16788.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 7057735..7057846 | 169..280 | 99 | -> | Minus |
arm_3R | 7057916..7057990 | 94..168 | 100 | -> | Minus |
arm_3R | 7058063..7058146 | 15..93 | 92 | -> | Minus |
BO16788.5prime Sequence
290 bp (290 high quality bases) assembled on 2006-10-13
> BO16788.5prime
GAAGTTATCCGTCGACATGAGCATCTATCACGACGAGGTGGAGATCGAGG
ACTTCGAGTACGACGAGGAGGAGGAGATGTACTACTATCCCTGTCCATGC
GGCGATCGATTTCAGATCTCCAAGGAGGAGCTAATCGAGGGCGAGGAGGT
GGCCACCTGTCCCAGCTGCTCCCTAGTCATCAAGGTCATATACGATCCGG
AGATGTTCAAAGCTGAGGAGGATGAAGAAAGTGCGCTGAACGAGAAGCTC
GGCGACCTGAAGCTCGAGAAGAACGCAAGCTTTCTAGACC
BO16788.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14701-PA | 261 | CG14701-RA | 1..258 | 17..274 | 1290 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:40:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14701-RA | 487 | CG14701-RA | 105..363 | 16..274 | 1295 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:40:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 11232016..11232125 | 16..125 | 550 | 100 | Plus |
3R | 32079331 | 3R | 11232192..11232269 | 123..200 | 390 | 100 | Plus |
3R | 32079331 | 3R | 11232340..11232415 | 199..274 | 380 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-10 16:40:30 has no hits.
BO16788.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:34 Download gff for
BO16788.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14701-PA | 1..261 | 17..278 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 20:18:49 Download gff for
BO16788.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14701-RA | 102..366 | 13..278 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:03:54 Download gff for
BO16788.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14701-RA | 102..366 | 13..278 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:03:54 Download gff for
BO16788.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 11232013..11232124 | 13..124 | 99 | -> | Plus |
3R | 11232194..11232268 | 125..199 | 100 | -> | Plus |
3R | 11232341..11232418 | 200..278 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 20:18:49 Download gff for
BO16788.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 7057735..7057846 | 13..124 | 99 | -> | Plus |
arm_3R | 7057916..7057990 | 125..199 | 100 | -> | Plus |
arm_3R | 7058063..7058140 | 200..278 | 97 | | Plus |
BO16788.complete Sequence
292 bp assembled on 2006-10-11
GenBank Submission: FJ633920
> BO16788.complete
GAAGTTATCAGTCGACATGAGCATCTATCACGACGAGGTGGAGATCGAGG
ACTTCGAGTACGACGAGGAGGAGGAGATGTACTACTATCCCTGTCCATGC
GGCGATCGATTTCAGATCTCCAAGGAGGAGCTAATCGAGGGCGAGGAGGT
GGCCACCTGTCCCAGCTGCTCCCTAGTCATCAAGGTCATATACGATCCGG
AGATGTTCAAAGCTGAGGAGGATGAAGAAAGTGCGCTGAACGAGAAGCTC
GGCGACCTGAAGCTCGAGAAGAACGCAAGCTTTCTAGACCAT
BO16788.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:05:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14701-RA | 261 | CG14701-PA | 1..258 | 17..274 | 1290 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:05:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14701-RA | 487 | CG14701-RA | 105..363 | 16..274 | 1295 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:05:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 11232016..11232125 | 16..125 | 550 | 100 | Plus |
3R | 32079331 | 3R | 11232192..11232269 | 123..200 | 390 | 100 | Plus |
3R | 32079331 | 3R | 11232340..11232415 | 199..274 | 380 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 08:05:48 has no hits.
BO16788.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:55 Download gff for
BO16788.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14701-RA | 1..261 | 17..278 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:48:36 Download gff for
BO16788.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14701-RA | 1..258 | 17..276 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:18:54 Download gff for
BO16788.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14701-RA | 106..363 | 17..276 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:55 Download gff for
BO16788.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14701-RA | 1..261 | 17..278 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:10:49 Download gff for
BO16788.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14701-RA | 106..363 | 17..276 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:10:49 Download gff for
BO16788.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 11232194..11232268 | 125..199 | 100 | -> | Plus |
3R | 11232341..11232415 | 200..276 | 97 | | Plus |
3R | 11232017..11232124 | 17..124 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:18:54 Download gff for
BO16788.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 7057739..7057846 | 17..124 | 100 | -> | Plus |
arm_3R | 7057916..7057990 | 125..199 | 100 | -> | Plus |
arm_3R | 7058063..7058137 | 200..276 | 97 | | Plus |
BO16788.pep Sequence
Translation from 16 to 292
> BO16788.pep
MSIYHDEVEIEDFEYDEEEEMYYYPCPCGDRFQISKEELIEGEEVATCPS
CSLVIKVIYDPEMFKAEEDEESALNEKLGDLKLEKNASFLDH
BO16788.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:47:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14701-PA | 86 | CG14701-PA | 1..86 | 1..86 | 460 | 100 | Plus |