Clone BO16788 Report

Search the DGRC for BO16788

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:167
Well:88
Vector:pDNR-Dual
Associated Gene/TranscriptCG14701-RA
Protein status:BO16788.pep: validated full length
Sequenced Size:292

Clone Sequence Records

BO16788.3prime Sequence

290 bp (290 high quality bases) assembled on 2006-10-13

> BO16788.3prime
ATGGTCTAGAAAGCTTGCGTTCTTCTCGAGCTTCAGGTCGCCGAGCTTCT
CGTTCAGCGCACTTTCTTCATCCTCCTCAGCTTTGAACATCTCCGGATCG
TATATGACCTTGATGACTAGGGAGCAGCTGGGACAGGTGGCCACCTCCTC
GCCCTCGATTAGCTCCTCCTTGGAGATCTGAAATCGATCGCCGCATGGAC
AGGGATAGTAGTACATCTCCTCCTCCTCGTCGTACTCGAAGTCCTCGATC
TCCACCTCGTCGTGATAGATGCTCATGTCGACTGATAACT

BO16788.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG14701-PA 261 CG14701-RA 1..258 276..19 1290 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:31:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG14701-RA 487 CG14701-RA 105..363 277..19 1295 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:31:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11232016..11232125 277..168 550 100 Minus
3R 32079331 3R 11232192..11232269 170..93 390 100 Minus
3R 32079331 3R 11232340..11232415 94..19 380 100 Minus
Blast to na_te.dros performed on 2015-02-10 17:31:10 has no hits.

BO16788.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:33 Download gff for BO16788.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14701-PA 1..261 15..276 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:41:22 Download gff for BO16788.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 102..366 15..280 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:57:51 Download gff for BO16788.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 102..366 15..280 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:57:51 Download gff for BO16788.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 11232013..11232124 169..280 99 -> Minus
3R 11232194..11232268 94..168 100 -> Minus
3R 11232341..11232424 15..93 92 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:41:22 Download gff for BO16788.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7057735..7057846 169..280 99 -> Minus
arm_3R 7057916..7057990 94..168 100 -> Minus
arm_3R 7058063..7058146 15..93 92 -> Minus

BO16788.5prime Sequence

290 bp (290 high quality bases) assembled on 2006-10-13

> BO16788.5prime
GAAGTTATCCGTCGACATGAGCATCTATCACGACGAGGTGGAGATCGAGG
ACTTCGAGTACGACGAGGAGGAGGAGATGTACTACTATCCCTGTCCATGC
GGCGATCGATTTCAGATCTCCAAGGAGGAGCTAATCGAGGGCGAGGAGGT
GGCCACCTGTCCCAGCTGCTCCCTAGTCATCAAGGTCATATACGATCCGG
AGATGTTCAAAGCTGAGGAGGATGAAGAAAGTGCGCTGAACGAGAAGCTC
GGCGACCTGAAGCTCGAGAAGAACGCAAGCTTTCTAGACC

BO16788.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG14701-PA 261 CG14701-RA 1..258 17..274 1290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:40:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG14701-RA 487 CG14701-RA 105..363 16..274 1295 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11232016..11232125 16..125 550 100 Plus
3R 32079331 3R 11232192..11232269 123..200 390 100 Plus
3R 32079331 3R 11232340..11232415 199..274 380 100 Plus
Blast to na_te.dros performed on 2015-02-10 16:40:30 has no hits.

BO16788.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:34 Download gff for BO16788.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14701-PA 1..261 17..278 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 20:18:49 Download gff for BO16788.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 102..366 13..278 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:03:54 Download gff for BO16788.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 102..366 13..278 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:03:54 Download gff for BO16788.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 11232013..11232124 13..124 99 -> Plus
3R 11232194..11232268 125..199 100 -> Plus
3R 11232341..11232418 200..278 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 20:18:49 Download gff for BO16788.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7057735..7057846 13..124 99 -> Plus
arm_3R 7057916..7057990 125..199 100 -> Plus
arm_3R 7058063..7058140 200..278 97   Plus

BO16788.complete Sequence

292 bp assembled on 2006-10-11

GenBank Submission: FJ633920

> BO16788.complete
GAAGTTATCAGTCGACATGAGCATCTATCACGACGAGGTGGAGATCGAGG
ACTTCGAGTACGACGAGGAGGAGGAGATGTACTACTATCCCTGTCCATGC
GGCGATCGATTTCAGATCTCCAAGGAGGAGCTAATCGAGGGCGAGGAGGT
GGCCACCTGTCCCAGCTGCTCCCTAGTCATCAAGGTCATATACGATCCGG
AGATGTTCAAAGCTGAGGAGGATGAAGAAAGTGCGCTGAACGAGAAGCTC
GGCGACCTGAAGCTCGAGAAGAACGCAAGCTTTCTAGACCAT

BO16788.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG14701-RA 261 CG14701-PA 1..258 17..274 1290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG14701-RA 487 CG14701-RA 105..363 16..274 1295 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11232016..11232125 16..125 550 100 Plus
3R 32079331 3R 11232192..11232269 123..200 390 100 Plus
3R 32079331 3R 11232340..11232415 199..274 380 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:05:48 has no hits.

BO16788.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:55 Download gff for BO16788.complete
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 1..261 17..278 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:48:36 Download gff for BO16788.complete
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 1..258 17..276 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:18:54 Download gff for BO16788.complete
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 106..363 17..276 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:55 Download gff for BO16788.complete
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 1..261 17..278 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:10:49 Download gff for BO16788.complete
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 106..363 17..276 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:10:49 Download gff for BO16788.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11232194..11232268 125..199 100 -> Plus
3R 11232341..11232415 200..276 97   Plus
3R 11232017..11232124 17..124 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:18:54 Download gff for BO16788.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7057739..7057846 17..124 100 -> Plus
arm_3R 7057916..7057990 125..199 100 -> Plus
arm_3R 7058063..7058137 200..276 97   Plus

BO16788.pep Sequence

Translation from 16 to 292

> BO16788.pep
MSIYHDEVEIEDFEYDEEEEMYYYPCPCGDRFQISKEELIEGEEVATCPS
CSLVIKVIYDPEMFKAEEDEESALNEKLGDLKLEKNASFLDH

BO16788.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:47:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG14701-PA 86 CG14701-PA 1..86 1..86 460 100 Plus