Clone Sequence Records
BO16789.3prime Sequence
320 bp (320 high quality bases) assembled on 2006-10-13
> BO16789.3prime
ATGGTCTAGAAAGCTTGCGACACATCCCGCTGGTTTGCTGATAGTGCAGA
ATTTGAGATCGGCATCAAAGAATTGCCCGGTCTTGCAGCTTTTGATTAGA
GCCCTCGTTGAGTCATTGACTTTATAACAATAGACGTAGCTGACGCATGT
GGAGTCATTCTGGTTCGCTATTATGACCGATTTATCCACATTCTGACACG
CCTCATCCGCACTCCAGGTGCCCGCGTCCAGATCCTTTAGCGCAGGCGCG
GCCCCGGCAAGCAGGCAGTGGACCAGGAGCAGTGATACAATTAGACTCGT
CCACATGTCGACTGATAACT
BO16789.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14957-PA | 291 | CG14957-RA | 1..288 | 306..19 | 1440 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:32:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14957-RA | 423 | CG14957-RA | 17..304 | 306..19 | 1440 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:32:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3187668..3187808 | 280..140 | 705 | 100 | Minus |
3L | 28110227 | 3L | 3187863..3187987 | 143..19 | 625 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-10 17:32:07 has no hits.
BO16789.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:34 Download gff for
BO16789.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14957-PA | 1..291 | 15..306 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:41:26 Download gff for
BO16789.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14957-RA | 5..307 | 15..319 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:57:57 Download gff for
BO16789.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14957-RA | 5..307 | 15..319 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:57:57 Download gff for
BO16789.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3187669..3187808 | 140..279 | 100 | -> | Minus |
3L | 3187867..3187990 | 15..139 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:41:26 Download gff for
BO16789.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3187669..3187808 | 140..279 | 100 | -> | Minus |
arm_3L | 3187867..3187990 | 15..139 | 98 | | Minus |
BO16789.5prime Sequence
320 bp (320 high quality bases) assembled on 2006-10-13
> BO16789.5prime
GAAGTTATCAGTCGACATGTGGACGAGTCTAATTGTATCACTGCTCCTGG
TCCACTGCCTGCTTGCCGGGGCCGCGCCTGCGCTAAAGGATCTGGACGCG
GGCACCTGGAGTGCGGATGAGGCGTGTCAGAATGTGGATAAATCGGTCAT
AATAGCGAACCAGAATGACTCCACATGCGTCAGCTACGTCTATTGTTATA
AAGTCAATGACTCAACGAGGGCTCTAATCAAAAGCTGCAAGACCGGGCAA
TTCTTTGATGCCGATCTCAAATTCTGCACTATCAGCAAACCAGCGGGATG
TGTCGCAAGCTTTCTAGACC
BO16789.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14957-PA | 291 | CG14957-RA | 1..288 | 17..304 | 1440 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:22:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14957-RA | 423 | CG14957-RA | 17..304 | 17..304 | 1440 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:22:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3187668..3187808 | 43..183 | 705 | 100 | Plus |
3L | 28110227 | 3L | 3187863..3187987 | 180..304 | 625 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-10 21:22:36 has no hits.
BO16789.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:35 Download gff for
BO16789.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14957-PA | 1..291 | 17..308 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 18:05:39 Download gff for
BO16789.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14957-RA | 5..307 | 4..308 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:41:09 Download gff for
BO16789.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14957-RA | 5..307 | 4..308 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:41:09 Download gff for
BO16789.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3187867..3187990 | 184..308 | 98 | | Plus |
3L | 3187669..3187808 | 44..183 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 18:05:39 Download gff for
BO16789.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3187867..3187990 | 184..308 | 98 | | Plus |
arm_3L | 3187669..3187808 | 44..183 | 100 | -> | Plus |
BO16789.complete Sequence
322 bp assembled on 2006-10-11
GenBank Submission: FJ633921
> BO16789.complete
GAAGTTATCAGTCGACATGTGGACGAGTCTAATTGTATCACTGCTCCTGG
TCCACTGCCTGCTTGCCGGGGCCGCGCCTGCGCTAAAGGATCTGGACGCG
GGCACCTGGAGTGCGGATGAGGCGTGTCAGAATGTGGATAAATCGGTCAT
AATAGCGAACCAGAATGACTCCACATGCGTCAGCTACGTCTATTGTTATA
AAGTCAATGACTCAACGAGGGCTCTAATCAAAAGCTGCAAGACCGGGCAA
TTCTTTGATGCCGATCTCAAATTCTGCACTATCAGCAAACCAGCGGGATG
TGTCGCAAGCTTTCTAGACCAT
BO16789.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:43:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14957-RA | 291 | CG14957-PA | 1..288 | 17..304 | 1440 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:43:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14957-RA | 423 | CG14957-RA | 17..304 | 17..304 | 1440 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:43:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3187668..3187808 | 43..183 | 705 | 100 | Plus |
3L | 28110227 | 3L | 3187863..3187987 | 180..304 | 625 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 00:43:33 has no hits.
BO16789.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:05:18 Download gff for
BO16789.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14957-RA | 1..291 | 17..308 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:20:08 Download gff for
BO16789.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14957-RA | 5..307 | 4..308 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:58:19 Download gff for
BO16789.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14957-RA | 17..304 | 17..306 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:05:19 Download gff for
BO16789.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14957-RA | 5..307 | 4..308 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:25:34 Download gff for
BO16789.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14957-RA | 17..304 | 17..306 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:25:34 Download gff for
BO16789.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3187867..3187987 | 184..306 | 98 | | Plus |
3L | 3187579..3187605 | 17..43 | 100 | -> | Plus |
3L | 3187669..3187808 | 44..183 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:58:19 Download gff for
BO16789.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3187867..3187987 | 184..306 | 98 | | Plus |
arm_3L | 3187579..3187605 | 17..43 | 100 | -> | Plus |
arm_3L | 3187669..3187808 | 44..183 | 100 | -> | Plus |
BO16789.pep Sequence
Translation from 16 to 322
> BO16789.pep
MWTSLIVSLLLVHCLLAGAAPALKDLDAGTWSADEACQNVDKSVIIANQN
DSTCVSYVYCYKVNDSTRALIKSCKTGQFFDADLKFCTISKPAGCVASFL
DH
BO16789.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:47:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14957-PA | 96 | CG14957-PA | 1..96 | 1..96 | 509 | 100 | Plus |
CG32284-PA | 102 | CG32284-PA | 1..97 | 1..97 | 256 | 50.5 | Plus |
CG42494-PC | 283 | CG42494-PC | 215..282 | 28..95 | 204 | 51.5 | Plus |
CG42494-PB | 283 | CG42494-PB | 215..282 | 28..95 | 204 | 51.5 | Plus |
CG42494-PA | 283 | CG42494-PA | 215..282 | 28..95 | 204 | 51.5 | Plus |
CG42494-PC | 283 | CG42494-PC | 123..189 | 31..96 | 160 | 40.3 | Plus |
CG42494-PB | 283 | CG42494-PB | 123..189 | 31..96 | 160 | 40.3 | Plus |