Clone BO16795 Report

Search the DGRC for BO16795

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:167
Well:95
Vector:pDNR-Dual
Associated Gene/TranscriptCG31704-RA
Protein status:BO16795.pep: validated full length
Sequenced Size:238

Clone Sequence Records

BO16795.3prime Sequence

236 bp (236 high quality bases) assembled on 2006-10-13

> BO16795.3prime
ATGGTCTAGAAAGCTTGCGCATCTTCCCTTCTTCTCCACGGTAATGGAGC
GTCCTTCTTTAATTAAACAATCCAAAACACACTGGTTACTATAGGTCACG
GAGTCCGATCCGCACACAGGATCATAGTTTCGAGGACACGGGCAGGAGTA
CTGGAATACCTGGCCCACAGCCATGGCCAAAAGAGCAGACAGACAGAAAG
CGATGAAGGCTAGGCAACGCATGTCGACTGATAACT

BO16795.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG31704-PA 207 CG31704-RA 1..204 222..19 1020 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG31704-RB 514 CG31704-RB 21..225 223..19 1025 100 Minus
CG31704-RA 308 CG31704-RA 21..225 223..19 1025 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11840711..11840915 223..19 1025 100 Minus
Blast to na_te.dros performed on 2015-02-10 16:02:01 has no hits.

BO16795.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:44 Download gff for BO16795.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31704-PA 1..207 18..222 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-19 20:09:43 Download gff for BO16795.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 21..225 19..223 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:41:34 Download gff for BO16795.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 21..225 19..223 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:41:34 Download gff for BO16795.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 11840711..11840915 19..223 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 20:09:43 Download gff for BO16795.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11840711..11840915 19..223 100   Minus

BO16795.5prime Sequence

236 bp (236 high quality bases) assembled on 2006-10-13

> BO16795.5prime
GAAGTTATCCGTCGACATGCGTTGCCTAGCCTTCATCGCTTTCTGTCTGT
CTGCTCTTTTGGCCATGGCTGTGGGCCAGGTATTCCAGTACTCCTGCCCG
TGTCCTCGAAACTATGATCCTGTGTGCGGATCGGACTCCGTGACCTATAG
TAACCAGTGTGTTTTGGATTGTTTAATTAAAGAAGGACGCTCCATTACCG
TGGAGAAGAAGGGAAGATGCGCAAGCTTTCTAGACC

BO16795.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG31704-PA 207 CG31704-RA 1..204 17..220 1020 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG31704-RB 514 CG31704-RB 21..225 16..220 1025 100 Plus
CG31704-RA 308 CG31704-RA 21..225 16..220 1025 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:06:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11840711..11840915 16..220 1025 100 Plus
Blast to na_te.dros performed on 2015-02-12 11:06:45 has no hits.

BO16795.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:44 Download gff for BO16795.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31704-PA 1..207 17..221 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:44:23 Download gff for BO16795.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 21..225 16..220 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:22:46 Download gff for BO16795.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 21..225 16..220 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:22:46 Download gff for BO16795.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 11840711..11840915 16..220 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:44:23 Download gff for BO16795.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11840711..11840915 16..220 100   Plus

BO16795.complete Sequence

238 bp assembled on 2006-10-11

GenBank Submission: FJ633923

> BO16795.complete
GAAGTTATCAGTCGACATGCGTTGCCTAGCCTTCATCGCTTTCTGTCTGT
CTGCTCTTTTGGCCATGGCTGTGGGCCAGGTATTCCAGTACTCCTGCCCG
TGTCCTCGAAACTATGATCCTGTGTGCGGATCGGACTCCGTGACCTATAG
TAACCAGTGTGTTTTGGATTGTTTAATTAAAGAAGGACGCTCCATTACCG
TGGAGAAGAAGGGAAGATGCGCAAGCTTTCTAGACCAT

BO16795.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:24:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG31704-RB 207 CG31704-PB 1..204 17..220 1020 100 Plus
CG31704-RA 207 CG31704-PA 1..204 17..220 1020 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:24:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG31704-RB 514 CG31704-RB 21..225 16..220 1025 100 Plus
CG31704-RA 308 CG31704-RA 21..225 16..220 1025 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:24:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11840711..11840915 16..220 1025 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:24:32 has no hits.

BO16795.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:39 Download gff for BO16795.complete
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 1..207 17..221 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:19:07 Download gff for BO16795.complete
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 21..225 16..220 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:14:21 Download gff for BO16795.complete
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 22..225 17..222 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:40 Download gff for BO16795.complete
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 1..207 17..221 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:10:02 Download gff for BO16795.complete
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 22..225 17..222 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:10:02 Download gff for BO16795.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11840712..11840915 17..222 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:14:21 Download gff for BO16795.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11840712..11840915 17..222 99   Plus

BO16795.pep Sequence

Translation from 16 to 238

> BO16795.pep
MRCLAFIAFCLSALLAMAVGQVFQYSCPCPRNYDPVCGSDSVTYSNQCVL
DCLIKEGRSITVEKKGRCASFLDH

BO16795.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG31704-PB 68 CG31704-PB 1..68 1..68 370 100 Plus
CG31704-PA 68 CG31704-PA 1..68 1..68 370 100 Plus
CG45011-PB 67 CG45011-PB 6..67 6..68 160 52.4 Plus
CG45011-PA 67 CG45011-PA 6..67 6..68 160 52.4 Plus
Sfp33A3-PA 99 CG42474-PA 1..65 1..68 153 50 Plus