Clone Sequence Records
BO16795.3prime Sequence
236 bp (236 high quality bases) assembled on 2006-10-13
> BO16795.3prime
ATGGTCTAGAAAGCTTGCGCATCTTCCCTTCTTCTCCACGGTAATGGAGC
GTCCTTCTTTAATTAAACAATCCAAAACACACTGGTTACTATAGGTCACG
GAGTCCGATCCGCACACAGGATCATAGTTTCGAGGACACGGGCAGGAGTA
CTGGAATACCTGGCCCACAGCCATGGCCAAAAGAGCAGACAGACAGAAAG
CGATGAAGGCTAGGCAACGCATGTCGACTGATAACT
BO16795.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31704-PA | 207 | CG31704-RA | 1..204 | 222..19 | 1020 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:02:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31704-RB | 514 | CG31704-RB | 21..225 | 223..19 | 1025 | 100 | Minus |
CG31704-RA | 308 | CG31704-RA | 21..225 | 223..19 | 1025 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:01:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11840711..11840915 | 223..19 | 1025 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-10 16:02:01 has no hits.
BO16795.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:44 Download gff for
BO16795.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31704-PA | 1..207 | 18..222 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-19 20:09:43 Download gff for
BO16795.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31704-RA | 21..225 | 19..223 | 100 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:41:34 Download gff for
BO16795.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31704-RA | 21..225 | 19..223 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:41:34 Download gff for
BO16795.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11840711..11840915 | 19..223 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 20:09:43 Download gff for
BO16795.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 11840711..11840915 | 19..223 | 100 | | Minus |
BO16795.5prime Sequence
236 bp (236 high quality bases) assembled on 2006-10-13
> BO16795.5prime
GAAGTTATCCGTCGACATGCGTTGCCTAGCCTTCATCGCTTTCTGTCTGT
CTGCTCTTTTGGCCATGGCTGTGGGCCAGGTATTCCAGTACTCCTGCCCG
TGTCCTCGAAACTATGATCCTGTGTGCGGATCGGACTCCGTGACCTATAG
TAACCAGTGTGTTTTGGATTGTTTAATTAAAGAAGGACGCTCCATTACCG
TGGAGAAGAAGGGAAGATGCGCAAGCTTTCTAGACC
BO16795.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31704-PA | 207 | CG31704-RA | 1..204 | 17..220 | 1020 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:06:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31704-RB | 514 | CG31704-RB | 21..225 | 16..220 | 1025 | 100 | Plus |
CG31704-RA | 308 | CG31704-RA | 21..225 | 16..220 | 1025 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:06:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11840711..11840915 | 16..220 | 1025 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-12 11:06:45 has no hits.
BO16795.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:44 Download gff for
BO16795.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31704-PA | 1..207 | 17..221 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:44:23 Download gff for
BO16795.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31704-RA | 21..225 | 16..220 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:22:46 Download gff for
BO16795.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31704-RA | 21..225 | 16..220 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:22:46 Download gff for
BO16795.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11840711..11840915 | 16..220 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:44:23 Download gff for
BO16795.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 11840711..11840915 | 16..220 | 100 | | Plus |
BO16795.complete Sequence
238 bp assembled on 2006-10-11
GenBank Submission: FJ633923
> BO16795.complete
GAAGTTATCAGTCGACATGCGTTGCCTAGCCTTCATCGCTTTCTGTCTGT
CTGCTCTTTTGGCCATGGCTGTGGGCCAGGTATTCCAGTACTCCTGCCCG
TGTCCTCGAAACTATGATCCTGTGTGCGGATCGGACTCCGTGACCTATAG
TAACCAGTGTGTTTTGGATTGTTTAATTAAAGAAGGACGCTCCATTACCG
TGGAGAAGAAGGGAAGATGCGCAAGCTTTCTAGACCAT
BO16795.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:24:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31704-RB | 207 | CG31704-PB | 1..204 | 17..220 | 1020 | 100 | Plus |
CG31704-RA | 207 | CG31704-PA | 1..204 | 17..220 | 1020 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:24:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31704-RB | 514 | CG31704-RB | 21..225 | 16..220 | 1025 | 100 | Plus |
CG31704-RA | 308 | CG31704-RA | 21..225 | 16..220 | 1025 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:24:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11840711..11840915 | 16..220 | 1025 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 07:24:32 has no hits.
BO16795.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:39 Download gff for
BO16795.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31704-RA | 1..207 | 17..221 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:19:07 Download gff for
BO16795.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31704-RA | 21..225 | 16..220 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:14:21 Download gff for
BO16795.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31704-RA | 22..225 | 17..222 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:40 Download gff for
BO16795.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31704-RA | 1..207 | 17..221 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:10:02 Download gff for
BO16795.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31704-RA | 22..225 | 17..222 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:10:02 Download gff for
BO16795.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11840712..11840915 | 17..222 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:14:21 Download gff for
BO16795.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 11840712..11840915 | 17..222 | 99 | | Plus |
BO16795.pep Sequence
Translation from 16 to 238
> BO16795.pep
MRCLAFIAFCLSALLAMAVGQVFQYSCPCPRNYDPVCGSDSVTYSNQCVL
DCLIKEGRSITVEKKGRCASFLDH
BO16795.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:22:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31704-PB | 68 | CG31704-PB | 1..68 | 1..68 | 370 | 100 | Plus |
CG31704-PA | 68 | CG31704-PA | 1..68 | 1..68 | 370 | 100 | Plus |
CG45011-PB | 67 | CG45011-PB | 6..67 | 6..68 | 160 | 52.4 | Plus |
CG45011-PA | 67 | CG45011-PA | 6..67 | 6..68 | 160 | 52.4 | Plus |
Sfp33A3-PA | 99 | CG42474-PA | 1..65 | 1..68 | 153 | 50 | Plus |