Clone Sequence Records
BO16802.3prime Sequence
251 bp (251 high quality bases) assembled on 2006-10-13
> BO16802.3prime
ATGGTCTAGAAAGCTTGCTTGGTAGTAAAGTTCCAGATTCATGCCATCGT
GAATTTCATAGTCAGATAGGCGAATCGGGTCCTTGAAGATTGTGTACCAC
TTCTTCAGGACAATCTTCTCGTGCTTTGTGCCCGTTTGTGCCGCGATTAG
TTTCTTGAGGTCCCCAATCGTGTCGTCCGGGTTGCACTTGACGCGCACCT
TCTTGCCAAGACGATCGTTACACGTTATTTCTATCATGTCGACTGATAAC
T
BO16802.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3450-PA | 222 | l(2)k03203-RA | 1..219 | 237..19 | 1095 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:33:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ubl-RA | 396 | CG3450-RA | 94..312 | 237..19 | 1095 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:33:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 6810201..6810341 | 60..200 | 705 | 100 | Plus |
2R | 25286936 | 2R | 6810095..6810135 | 19..59 | 205 | 100 | Plus |
2R | 25286936 | 2R | 6810397..6810437 | 197..237 | 205 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-10 17:33:50 has no hits.
BO16802.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:47 Download gff for
BO16802.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3450-PA | 1..222 | 15..237 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:41:36 Download gff for
BO16802.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ubl-RA | 94..319 | 12..237 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:58:12 Download gff for
BO16802.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ubl-RA | 94..319 | 12..237 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:58:12 Download gff for
BO16802.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 6810088..6810135 | 12..59 | 93 | <- | Plus |
2R | 6810201..6810339 | 60..198 | 100 | <- | Plus |
2R | 6810399..6810437 | 199..237 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:41:36 Download gff for
BO16802.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 2697593..2697640 | 12..59 | 93 | <- | Plus |
arm_2R | 2697706..2697844 | 60..198 | 100 | <- | Plus |
arm_2R | 2697904..2697942 | 199..237 | 100 | | Plus |
BO16802.5prime Sequence
251 bp (251 high quality bases) assembled on 2006-10-13
> BO16802.5prime
GAAGTTATCAGTCGACATGATAGAAATAACGTGTAACGATCGTCTTGGCA
AGAAGGTGCGCGTCAAGTGCAACCCGGACGACACGATTGGGGACCTCAAG
AAACTAATCGCGGCACAAACGGGCACAAAGCACGAGAAGATTGTCCTGAA
GAAGTGGTACACAATCTTCAAGGACCCGATTCGCCTATCTGACTATGAAA
TTCACGATGGCATGAATCTGGAACTTTACTACCAAGCAAGCTTTCTAGAC
C
BO16802.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3450-PA | 222 | l(2)k03203-RA | 1..219 | 17..235 | 1095 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 03:53:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ubl-RA | 396 | CG3450-RA | 94..312 | 17..235 | 1095 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 03:52:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 6810201..6810341 | 194..54 | 705 | 100 | Minus |
2R | 25286936 | 2R | 6810095..6810135 | 235..195 | 205 | 100 | Minus |
2R | 25286936 | 2R | 6810397..6810437 | 57..17 | 205 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-12 03:53:00 has no hits.
BO16802.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:49 Download gff for
BO16802.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3450-PA | 1..222 | 17..239 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 21:31:21 Download gff for
BO16802.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ubl-RA | 94..319 | 17..242 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:45:47 Download gff for
BO16802.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ubl-RA | 94..319 | 17..242 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 06:45:47 Download gff for
BO16802.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 6810201..6810339 | 56..194 | 100 | <- | Minus |
2R | 6810399..6810437 | 17..55 | 100 | | Minus |
2R | 6810088..6810135 | 195..242 | 93 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 21:31:21 Download gff for
BO16802.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 2697706..2697844 | 56..194 | 100 | <- | Minus |
arm_2R | 2697904..2697942 | 17..55 | 100 | | Minus |
arm_2R | 2697593..2697640 | 195..242 | 93 | <- | Minus |
BO16802.complete Sequence
253 bp assembled on 2006-10-11
GenBank Submission: FJ633924
> BO16802.complete
GAAGTTATCAGTCGACATGATAGAAATAACGTGTAACGATCGTCTTGGCA
AGAAGGTGCGCGTCAAGTGCAACCCGGACGACACGATTGGGGACCTCAAG
AAACTAATCGCGGCACAAACGGGCACAAAGCACGAGAAGATTGTCCTGAA
GAAGTGGTACACAATCTTCAAGGACCCGATTCGCCTATCTGACTATGAAA
TTCACGATGGCATGAATCTGGAACTTTACTACCAAGCAAGCTTTCTAGAC
CAT
BO16802.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:25:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ubl-RA | 222 | CG3450-PA | 1..219 | 17..235 | 1095 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:25:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ubl-RA | 396 | CG3450-RA | 94..312 | 17..235 | 1095 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:25:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 6810201..6810341 | 194..54 | 705 | 100 | Minus |
2R | 25286936 | 2R | 6810095..6810135 | 235..195 | 205 | 100 | Minus |
2R | 25286936 | 2R | 6810397..6810437 | 57..17 | 205 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 15:25:29 has no hits.
BO16802.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:43 Download gff for
BO16802.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ubl-RA | 1..222 | 17..239 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:19:14 Download gff for
BO16802.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ubl-RA | 78..303 | 17..242 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:46:33 Download gff for
BO16802.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ubl-RA | 94..312 | 17..237 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:44 Download gff for
BO16802.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ubl-RA | 78..303 | 17..242 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:07:22 Download gff for
BO16802.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ubl-RA | 94..312 | 17..237 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:07:22 Download gff for
BO16802.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 6810093..6810135 | 195..237 | 95 | <- | Minus |
2R | 6810201..6810339 | 56..194 | 100 | <- | Minus |
2R | 6810399..6810437 | 17..55 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:46:33 Download gff for
BO16802.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 2697598..2697640 | 195..237 | 95 | <- | Minus |
arm_2R | 2697706..2697844 | 56..194 | 100 | <- | Minus |
arm_2R | 2697904..2697942 | 17..55 | 100 | | Minus |
BO16802.pep Sequence
Translation from 16 to 253
> BO16802.pep
MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTI
FKDPIRLSDYEIHDGMNLELYYQASFLDH
BO16802.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:22:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ubl-PA | 73 | CG3450-PA | 1..73 | 1..73 | 391 | 100 | Plus |