Clone BO16802 Report

Search the DGRC for BO16802

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:168
Well:2
Vector:pDNR-Dual
Associated Gene/Transcriptubl-RA
Protein status:BO16802.pep: validated full length
Sequenced Size:253

Clone Sequence Records

BO16802.3prime Sequence

251 bp (251 high quality bases) assembled on 2006-10-13

> BO16802.3prime
ATGGTCTAGAAAGCTTGCTTGGTAGTAAAGTTCCAGATTCATGCCATCGT
GAATTTCATAGTCAGATAGGCGAATCGGGTCCTTGAAGATTGTGTACCAC
TTCTTCAGGACAATCTTCTCGTGCTTTGTGCCCGTTTGTGCCGCGATTAG
TTTCTTGAGGTCCCCAATCGTGTCGTCCGGGTTGCACTTGACGCGCACCT
TCTTGCCAAGACGATCGTTACACGTTATTTCTATCATGTCGACTGATAAC
T

BO16802.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG3450-PA 222 l(2)k03203-RA 1..219 237..19 1095 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:33:54
Subject Length Description Subject Range Query Range Score Percent Strand
ubl-RA 396 CG3450-RA 94..312 237..19 1095 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6810201..6810341 60..200 705 100 Plus
2R 25286936 2R 6810095..6810135 19..59 205 100 Plus
2R 25286936 2R 6810397..6810437 197..237 205 100 Plus
Blast to na_te.dros performed on 2015-02-10 17:33:50 has no hits.

BO16802.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:47 Download gff for BO16802.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3450-PA 1..222 15..237 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:41:36 Download gff for BO16802.3prime
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 94..319 12..237 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:58:12 Download gff for BO16802.3prime
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 94..319 12..237 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:58:12 Download gff for BO16802.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 6810088..6810135 12..59 93 <- Plus
2R 6810201..6810339 60..198 100 <- Plus
2R 6810399..6810437 199..237 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:41:36 Download gff for BO16802.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2697593..2697640 12..59 93 <- Plus
arm_2R 2697706..2697844 60..198 100 <- Plus
arm_2R 2697904..2697942 199..237 100   Plus

BO16802.5prime Sequence

251 bp (251 high quality bases) assembled on 2006-10-13

> BO16802.5prime
GAAGTTATCAGTCGACATGATAGAAATAACGTGTAACGATCGTCTTGGCA
AGAAGGTGCGCGTCAAGTGCAACCCGGACGACACGATTGGGGACCTCAAG
AAACTAATCGCGGCACAAACGGGCACAAAGCACGAGAAGATTGTCCTGAA
GAAGTGGTACACAATCTTCAAGGACCCGATTCGCCTATCTGACTATGAAA
TTCACGATGGCATGAATCTGGAACTTTACTACCAAGCAAGCTTTCTAGAC
C

BO16802.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG3450-PA 222 l(2)k03203-RA 1..219 17..235 1095 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 03:53:01
Subject Length Description Subject Range Query Range Score Percent Strand
ubl-RA 396 CG3450-RA 94..312 17..235 1095 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 03:52:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6810201..6810341 194..54 705 100 Minus
2R 25286936 2R 6810095..6810135 235..195 205 100 Minus
2R 25286936 2R 6810397..6810437 57..17 205 100 Minus
Blast to na_te.dros performed on 2015-02-12 03:53:00 has no hits.

BO16802.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:49 Download gff for BO16802.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3450-PA 1..222 17..239 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 21:31:21 Download gff for BO16802.5prime
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 94..319 17..242 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:45:47 Download gff for BO16802.5prime
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 94..319 17..242 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 06:45:47 Download gff for BO16802.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 6810201..6810339 56..194 100 <- Minus
2R 6810399..6810437 17..55 100   Minus
2R 6810088..6810135 195..242 93 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 21:31:21 Download gff for BO16802.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2697706..2697844 56..194 100 <- Minus
arm_2R 2697904..2697942 17..55 100   Minus
arm_2R 2697593..2697640 195..242 93 <- Minus

BO16802.complete Sequence

253 bp assembled on 2006-10-11

GenBank Submission: FJ633924

> BO16802.complete
GAAGTTATCAGTCGACATGATAGAAATAACGTGTAACGATCGTCTTGGCA
AGAAGGTGCGCGTCAAGTGCAACCCGGACGACACGATTGGGGACCTCAAG
AAACTAATCGCGGCACAAACGGGCACAAAGCACGAGAAGATTGTCCTGAA
GAAGTGGTACACAATCTTCAAGGACCCGATTCGCCTATCTGACTATGAAA
TTCACGATGGCATGAATCTGGAACTTTACTACCAAGCAAGCTTTCTAGAC
CAT

BO16802.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:25:30
Subject Length Description Subject Range Query Range Score Percent Strand
ubl-RA 222 CG3450-PA 1..219 17..235 1095 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:25:32
Subject Length Description Subject Range Query Range Score Percent Strand
ubl-RA 396 CG3450-RA 94..312 17..235 1095 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:25:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6810201..6810341 194..54 705 100 Minus
2R 25286936 2R 6810095..6810135 235..195 205 100 Minus
2R 25286936 2R 6810397..6810437 57..17 205 100 Minus
Blast to na_te.dros performed on 2014-11-27 15:25:29 has no hits.

BO16802.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:43 Download gff for BO16802.complete
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 1..222 17..239 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:19:14 Download gff for BO16802.complete
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 78..303 17..242 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:46:33 Download gff for BO16802.complete
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 94..312 17..237 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:44 Download gff for BO16802.complete
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 78..303 17..242 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:07:22 Download gff for BO16802.complete
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 94..312 17..237 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:07:22 Download gff for BO16802.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6810093..6810135 195..237 95 <- Minus
2R 6810201..6810339 56..194 100 <- Minus
2R 6810399..6810437 17..55 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:46:33 Download gff for BO16802.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2697598..2697640 195..237 95 <- Minus
arm_2R 2697706..2697844 56..194 100 <- Minus
arm_2R 2697904..2697942 17..55 100   Minus

BO16802.pep Sequence

Translation from 16 to 253

> BO16802.pep
MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTI
FKDPIRLSDYEIHDGMNLELYYQASFLDH

BO16802.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:22:39
Subject Length Description Subject Range Query Range Score Percent Strand
ubl-PA 73 CG3450-PA 1..73 1..73 391 100 Plus