Clone BO16808 Report

Search the DGRC for BO16808

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:168
Well:8
Vector:pDNR-Dual
Associated Gene/TranscriptCG13323-RA
Protein status:BO16808.pep: validated full length
Sequenced Size:370

Clone Sequence Records

BO16808.3prime Sequence

368 bp (368 high quality bases) assembled on 2006-10-13

> BO16808.3prime
ATGGTCTAGAAAGCTTGCACGACCCCAGATCTCGACGGTGGAGTTGATTC
CGCGGTTCACCTGACCACGAAGATTCACGGTGGCGAAGCGATAGCCCGGA
CCGCCGGAATAGAGGCTAGGAGATGCGCCGGAGTTGTTCTTAAAGTTGTC
GTAGACGATCACGGCGGAGATGTTGTAGAATCCGGCGGGATAGTTCACGT
TCACGTTCCAGTAGTTGTTCTTGATCGGATTGCGGACTTCCGTGGTGCGG
GACAGCAGGTAGTCGTTGTTATTGCGACGCCCCCAGGTGGCGCCGTAGGC
GTGGCAGCCAAGGATCACGGCCAGGACAACTGAGAGGATGAGCAGAAGAC
GCATGTCGACTGATAACT

BO16808.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13323-PA 339 CG13323-RA 1..336 354..19 1680 100 Minus
CG13324-PA 339 CG13324-RA 172..336 183..19 650 95.7 Minus
CG13324-PA 339 CG13324-RA 1..77 354..278 335 97.4 Minus
CG13324-PA 339 CG13324-RA 106..164 249..191 245 96.6 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG13323-RB 2562 CG13323-RB 39..376 356..19 1690 100 Minus
CG13323-RA 521 CG13323-RA 39..376 356..19 1690 100 Minus
CG13324-RA 511 CG13324-RA 37..374 356..19 1300 92.3 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 09:08:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13046881..13047218 19..356 1690 100 Plus
2R 25286936 2R 13049283..13049620 19..356 1300 92.3 Plus
Blast to na_te.dros performed on 2015-02-11 09:08:33 has no hits.

BO16808.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:54 Download gff for BO16808.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13323-PA 1..339 15..354 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 17:01:16 Download gff for BO16808.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13323-RA 33..380 14..362 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:56:31 Download gff for BO16808.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13323-RA 33..380 14..362 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 10:56:31 Download gff for BO16808.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 13046877..13047224 14..362 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 17:01:16 Download gff for BO16808.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8934382..8934729 14..362 98   Plus

BO16808.5prime Sequence

368 bp (368 high quality bases) assembled on 2006-10-13

> BO16808.5prime
GAAGTTATCAGTCGACATGCGTCTTCTGCTCATCCTCTCAGTTGTCCTGG
CCGTGATCCTTGGCTGCCACGCCTACGGCGCCACCTGGGGGCGTCGCAAT
AACAACGACTACCTGCTGTCCCGCACCACGGAAGTCCGCAATCCGATCAA
GAACAACTACTGGAACGTGAACGTGAACTATCCCGCCGGATTCTACAACA
TCTCCGCCGTGATCGTCTACGACAACTTTAAGAACAACTCCGGCGCATCT
CCTAGCCTCTATTCCGGCGGTCCGGGCTATCGCTTCGCCACCGTGAATCT
TCGTGGTCAGGTGAACCGCGGAATCAACTCCACCGTCGAGATCTGGGGTC
GTGCAAGCTTTCTAGACC

BO16808.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG13323-PA 339 CG13323-RA 1..336 17..352 1680 100 Plus
CG13324-PA 339 CG13324-RA 172..336 188..352 650 95.7 Plus
CG13324-PA 339 CG13324-RA 1..77 17..93 335 97.4 Plus
CG13324-PA 339 CG13324-RA 106..164 122..180 245 96.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 11:50:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG13323-RB 2562 CG13323-RB 39..376 15..352 1690 100 Plus
CG13323-RA 521 CG13323-RA 39..376 15..352 1690 100 Plus
CG13324-RA 511 CG13324-RA 37..374 15..352 1300 92.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 11:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13046881..13047218 352..15 1690 100 Minus
2R 25286936 2R 13049283..13049620 352..15 1300 92.3 Minus
Blast to na_te.dros performed on 2015-02-08 11:50:46 has no hits.

BO16808.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:56:55 Download gff for BO16808.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13323-PA 1..339 17..356 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:37:22 Download gff for BO16808.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13323-RA 33..380 9..357 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 13:42:37 Download gff for BO16808.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13323-RA 33..380 9..357 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 13:42:37 Download gff for BO16808.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 13046877..13047224 9..357 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:37:22 Download gff for BO16808.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8934382..8934729 9..357 98   Minus

BO16808.complete Sequence

370 bp assembled on 2006-10-11

GenBank Submission: FJ633926

> BO16808.complete
GAAGTTATCAGTCGACATGCGTCTTCTGCTCATCCTCTCAGTTGTCCTGG
CCGTGATCCTTGGCTGCCACGCCTACGGCGCCACCTGGGGGCGTCGCAAT
AACAACGACTACCTGCTGTCCCGCACCACGGAAGTCCGCAATCCGATCAA
GAACAACTACTGGAACGTGAACGTGAACTATCCCGCCGGATTCTACAACA
TCTCCGCCGTGATCGTCTACGACAACTTTAAGAACAACTCCGGCGCATCT
CCTAGCCTCTATTCCGGCGGTCCGGGCTATCGCTTCGCCACCGTGAATCT
TCGTGGTCAGGTGAACCGCGGAATCAACTCCACCGTCGAGATCTGGGGTC
GTGCAAGCTTTCTAGACCAT

BO16808.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:12:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG13323-RB 339 CG13323-PB 1..336 17..352 1680 100 Plus
CG13323-RA 339 CG13323-PA 1..336 17..352 1680 100 Plus
CG13324-RA 339 CG13324-PA 1..336 17..352 1290 92.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:12:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG13323-RB 2562 CG13323-RB 39..376 15..352 1690 100 Plus
CG13323-RA 521 CG13323-RA 39..376 15..352 1690 100 Plus
CG13324-RA 511 CG13324-RA 37..374 15..352 1300 92.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:12:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13046881..13047218 352..15 1690 100 Minus
2R 25286936 2R 13049283..13049620 352..15 1300 92.3 Minus
Blast to na_te.dros performed on 2014-11-26 16:12:09 has no hits.

BO16808.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:06:40 Download gff for BO16808.complete
Subject Subject Range Query Range Percent Splice Strand
CG13323-RA 1..339 17..356 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:22:18 Download gff for BO16808.complete
Subject Subject Range Query Range Percent Splice Strand
CG13323-RA 65..412 9..357 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:54:49 Download gff for BO16808.complete
Subject Subject Range Query Range Percent Splice Strand
CG13323-RA 41..376 17..354 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:06:41 Download gff for BO16808.complete
Subject Subject Range Query Range Percent Splice Strand
CG13323-RA 65..412 9..357 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:13:30 Download gff for BO16808.complete
Subject Subject Range Query Range Percent Splice Strand
CG13323-RA 41..376 17..354 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:13:30 Download gff for BO16808.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13046879..13047216 17..354 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:54:49 Download gff for BO16808.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8934384..8934721 17..354 99   Minus

BO16808.pep Sequence

Translation from 16 to 370

> BO16808.pep
MRLLLILSVVLAVILGCHAYGATWGRRNNNDYLLSRTTEVRNPIKNNYWN
VNVNYPAGFYNISAVIVYDNFKNNSGASPSLYSGGPGYRFATVNLRGQVN
RGINSTVEIWGRASFLDH

BO16808.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG13323-PB 112 CG13323-PB 1..112 1..112 598 100 Plus
CG13323-PA 112 CG13323-PA 1..112 1..112 598 100 Plus
CG13324-PA 112 CG13324-PA 1..112 1..112 562 94.6 Plus
CG31789-PC 117 CG31789-PC 4..114 1..110 145 32.5 Plus
CG31789-PB 117 CG31789-PB 4..114 1..110 145 32.5 Plus