Clone BO16832 Report

Search the DGRC for BO16832

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:168
Well:32
Vector:pDNR-Dual
Associated Gene/TranscriptCG14628-RA
Protein status:BO16832.pep: validated full length
Sequenced Size:457

Clone Sequence Records

BO16832.3prime Sequence

455 bp (455 high quality bases) assembled on 2006-10-13

> BO16832.3prime
ATGGTCTAGAAAGCTTGCTATAAAATTAGCATTATACAGTTGCATGTCTC
CCGGGCCATCTTCGTCATCACTTTCGGAGTAATCATCGTATTCATCGACG
TCATCCTCATCAGACCACTCGATCATCATCTGCCCCGGGGGAGCATAGCC
CAAGCAACTGGCGTTGAGCGAACGGAAGCTTGCGTTCGAAACAAGGATAA
CCTTAGATTTGAAGGTAGTATGGTCGAGCGTCTCTATGGCGAGCTTGGCC
TCGCTCTCCCTAGCGAACTGGATAAACCCCTGGTTATTGGTGACCAGCGA
GCCAAGGATTTCGCCGAAGGGCAAGCAGAGGTAAGCCAGCTCCTGGCGGG
TGCATACCGGAAGGTTTCTCACAAGGATCCTGCTCTTCAGACCAGTCGGT
CCACTGGTGAGTTCAATTCCCGCGATATCACTTGCAGACATGTCGACTGA
TAACT

BO16832.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:10:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG14628-PA 426 CG14628-RA 1..423 441..19 2115 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:31:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG14628-RA 489 CG14628-RA 35..457 441..19 2115 100 Minus
fz3-RB 2304 CG16785-RB 64..410 441..98 900 84.1 Minus
CG18823-RA 667 CG18823-RA 88..306 400..182 495 82.3 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:31:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1145678..1146100 441..19 2115 100 Minus
X 23542271 X 777797..778143 441..98 875 84.1 Minus
X 23542271 X 21152371..21152711 101..441 550 77.4 Plus
X 23542271 X 21163547..21163887 101..441 550 77.4 Plus
X 23542271 X 990605..990823 400..182 495 81.7 Minus
U 3151297 U 3102340..3102485 441..296 415 85.6 Minus
Blast to na_te.dros performed on 2015-02-11 17:31:05 has no hits.

BO16832.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:57:28 Download gff for BO16832.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14628-PA 1..426 15..441 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 10:22:25 Download gff for BO16832.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14628-RA 35..460 15..441 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:11:38 Download gff for BO16832.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14628-RA 35..460 15..441 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:11:38 Download gff for BO16832.3prime
Subject Subject Range Query Range Percent Splice Strand
X 1145678..1146103 15..441 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 10:22:25 Download gff for BO16832.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 1039711..1040136 15..441 99   Minus

BO16832.5prime Sequence

455 bp (455 high quality bases) assembled on 2006-10-13

> BO16832.5prime
GAAGTTATCAGTCGACATGTCTGCAAGTGATATCGCGGGAATTGAACTCA
CCAGTGGACCGACTGGTCTGAAGAGCAGGATCCTTGTGAGAAACCTTCCG
GTATGCACCCGCCAGGAGCTGGCTTACCTCTGCTTGCCCTTCGGCGAAAT
CCTTGGCTCGCTGGTCACCAATAACCAGGGGTTTATCCAGTTCGCTAGGG
AGAGCGAGGCCAAGCTCGCCATAGAGACGCTCGACCATACTACCTTCAAA
TCTAAGGTTATCCTTGTTTCGAACGCAAGCTTCCGTTCGCTCAACGCCAG
TTGCTTGGGCTATGCTCCCCCGGGGCAGATGATGATCGAGTGGTCTGATG
AGGATGACGTCGATGAATACGATGATTACTCCGAAAGTGATGACGAAGAT
GGCCCGGGAGACATGCAACTGTATAATGCTAATTTTATAGCAAGCTTTCT
AGACC

BO16832.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:10:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG14628-PA 426 CG14628-RA 1..423 17..439 2115 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG14628-RA 489 CG14628-RA 35..457 17..439 2115 100 Plus
fz3-RB 2304 CG16785-RB 64..410 17..360 900 84.1 Plus
CG18823-RA 667 CG18823-RA 88..306 58..276 495 82.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:57:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1145678..1146100 17..439 2115 100 Plus
X 23542271 X 777797..778143 17..360 875 84.1 Plus
X 23542271 X 21152371..21152711 357..17 550 77.4 Minus
X 23542271 X 21163547..21163887 357..17 550 77.4 Minus
X 23542271 X 990605..990823 58..276 495 81.7 Plus
U 3151297 U 3102340..3102485 17..162 415 85.6 Plus
Blast to na_te.dros performed on 2015-02-10 20:57:03 has no hits.

BO16832.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:57:29 Download gff for BO16832.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14628-PA 1..426 17..443 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 06:23:17 Download gff for BO16832.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14628-RA 35..460 17..443 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:34:16 Download gff for BO16832.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14628-RA 35..460 17..443 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:34:16 Download gff for BO16832.5prime
Subject Subject Range Query Range Percent Splice Strand
X 1145678..1146103 17..443 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 06:23:17 Download gff for BO16832.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 1039711..1040136 17..443 99   Plus

BO16832.complete Sequence

457 bp assembled on 2006-10-11

GenBank Submission: FJ633936

> BO16832.complete
GAAGTTATCAGTCGACATGTCTGCAAGTGATATCGCGGGAATTGAACTCA
CCAGTGGACCGACTGGTCTGAAGAGCAGGATCCTTGTGAGAAACCTTCCG
GTATGCACCCGCCAGGAGCTGGCTTACCTCTGCTTGCCCTTCGGCGAAAT
CCTTGGCTCGCTGGTCACCAATAACCAGGGGTTTATCCAGTTCGCTAGGG
AGAGCGAGGCCAAGCTCGCCATAGAGACGCTCGACCATACTACCTTCAAA
TCTAAGGTTATCCTTGTTTCGAACGCAAGCTTCCGTTCGCTCAACGCCAG
TTGCTTGGGCTATGCTCCCCCGGGGCAGATGATGATCGAGTGGTCTGATG
AGGATGACGTCGATGAATACGATGATTACTCCGAAAGTGATGACGAAGAT
GGCCCGGGAGACATGCAACTGTATAATGCTAATTTTATAGCAAGCTTTCT
AGACCAT

BO16832.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:32:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG14628-RA 426 CG14628-PA 1..423 17..439 2115 100 Plus
fz3-RB 1941 CG16785-PB 1..347 17..360 875 84.1 Plus
CG18823-RA 321 CG18823-PA 24..242 58..276 495 81.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG14628-RA 489 CG14628-RA 35..457 17..439 2115 100 Plus
fz3-RB 2304 CG16785-RB 64..410 17..360 875 84.1 Plus
CG18823-RA 667 CG18823-RA 88..306 58..276 495 81.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1145678..1146100 17..439 2115 100 Plus
X 23542271 X 777797..778143 17..360 875 84.1 Plus
X 23542271 X 21163547..21163887 357..17 550 77.4 Minus
X 23542271 X 21152371..21152711 357..17 550 77.4 Minus
X 23542271 X 990605..990823 58..276 495 81.7 Plus
U 3151297 U 3102340..3102485 17..162 415 85.6 Plus
Blast to na_te.dros performed on 2014-11-28 00:32:34 has no hits.

BO16832.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:06:25 Download gff for BO16832.complete
Subject Subject Range Query Range Percent Splice Strand
CG14628-RA 1..426 17..443 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:21:55 Download gff for BO16832.complete
Subject Subject Range Query Range Percent Splice Strand
CG14628-RA 35..460 17..443 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:54:17 Download gff for BO16832.complete
Subject Subject Range Query Range Percent Splice Strand
CG14628-RA 35..457 17..441 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:06:26 Download gff for BO16832.complete
Subject Subject Range Query Range Percent Splice Strand
CG14628-RA 35..460 17..443 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:22:18 Download gff for BO16832.complete
Subject Subject Range Query Range Percent Splice Strand
CG14628-RA 35..457 17..441 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:22:18 Download gff for BO16832.complete
Subject Subject Range Query Range Percent Splice Strand
X 1145678..1146100 17..441 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:54:17 Download gff for BO16832.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1039711..1040133 17..441 99   Plus

BO16832.pep Sequence

Translation from 16 to 457

> BO16832.pep
MSASDIAGIELTSGPTGLKSRILVRNLPVCTRQELAYLCLPFGEILGSLV
TNNQGFIQFARESEAKLAIETLDHTTFKSKVILVSNASFRSLNASCLGYA
PPGQMMIEWSDEDDVDEYDDYSESDDEDGPGDMQLYNANFIASFLDH

BO16832.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:03:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG14628-PA 141 CG14628-PA 1..141 1..141 729 100 Plus
fz3-PB 646 CG16785-PB 1..137 1..129 439 68.6 Plus
CG18823-PA 106 CG18823-PA 9..106 15..121 285 57 Plus
Neos-PB 371 CG8614-PB 1..97 1..97 217 45.4 Plus
Neos-PA 371 CG8614-PA 1..97 1..97 217 45.4 Plus