Clone Sequence Records
BO16859.complete Sequence
367 bp assembled on 2008-11-10
GenBank Submission: KX798661
> BO16859.complete
GAAGTTATCAGTCGACATGAAATTGAAAATCAATCTGACGTTCCTCCGTG
CGACACTCGTCGGTCTCCTGTCCATCATCCTCCTGACACAGACCGCGCAT
ATCGAGGCCTTTGGAAGCGGAGGCAGCTCTTCTGGCAATGGGGCAGTGGT
GTCGTGCAAAGAGCTGAACAATTTCAACTGCTATGTGGGCCGCAACGAGG
GTAACTTTTGCAGCAGGAAGGATCAGACCAAGGTCGTTACACGCTGGTAC
TTCGACAAGGGCGTCTGCAAGCCCTTCAACTATAAAGGATGCAACGGCAA
TCGCAATCGCTTCTGCTCGCAGGAAAGCTGCGATGCACGCTGCGGCGATG
CAAGCTTTCTAGACCAT
BO16859.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:06:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14298-RB | 336 | CG14298-PB | 1..333 | 17..349 | 1665 | 100 | Plus |
CG14298-RA | 336 | CG14298-PA | 1..333 | 17..349 | 1665 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:06:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14298-RB | 875 | CG14298-RB | 256..590 | 15..349 | 1675 | 100 | Plus |
CG14298-RA | 695 | CG14298-RA | 76..410 | 15..349 | 1675 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:06:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 18876738..18876919 | 168..349 | 910 | 100 | Plus |
3R | 32079331 | 3R | 18875783..18875935 | 15..167 | 765 | 100 | Plus |
Blast to na_te.dros performed 2014-11-27 14:06:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3S18 | 6126 | 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). | 2585..2622 | 290..328 | 102 | 80 | Plus |
BO16859.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:17:32 Download gff for
BO16859.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14298-RA | 76..410 | 15..349 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:46 Download gff for
BO16859.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14298-RA | 78..410 | 17..351 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:26:56 Download gff for
BO16859.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14298-RA | 78..410 | 17..351 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:03:24 Download gff for
BO16859.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14298-RA | 78..410 | 17..351 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:03:24 Download gff for
BO16859.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18875785..18875935 | 17..167 | 100 | -> | Plus |
3R | 18876738..18876919 | 168..351 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:46 Download gff for
BO16859.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 14701507..14701657 | 17..167 | 100 | -> | Plus |
arm_3R | 14702460..14702641 | 168..351 | 98 | | Plus |
BO16859.5prime Sequence
365 bp (365 high quality bases) assembled on 2006-10-13
> BO16859.5prime
GAAGTTATCAGTCGACATGAAATTGAAAATCAATCTGACGTTCCTCCGTG
CGACACTCGTCGGTCTCCTGTCCATCATCCTCCTGACACAGACCGCGCAT
ATCGAGGCCTTTGGAAGCGGAGGCAGCTCTTCTGGCAATGGGGCAGTGGT
GTCGTGCAAAGAGCTGAACAATTTCAACTGCTATGTGGGCCGCAACGAGG
GTAACTTTTGCAGCAGGAAGGATCAGACCAAGGTCGTTACACGCTGGTAC
TTCGACAAGGGCGTCTGCAAGCCCTTCAACTATAAAGGATGCAACGGCAA
TCGCAATCGCTTCTGCTCGCAGGAAAGCTGCGATGCACGCTGCGGCGATG
CAAGCTTTCTAGACC
BO16859.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 16:41:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14298-PA | 336 | CG14298-RA | 1..333 | 17..349 | 1665 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 17:34:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14298-RB | 875 | CG14298-RB | 256..590 | 15..349 | 1675 | 100 | Plus |
CG14298-RA | 695 | CG14298-RA | 76..410 | 15..349 | 1675 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 17:34:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 18876738..18876919 | 168..349 | 910 | 100 | Plus |
3R | 32079331 | 3R | 18875783..18875935 | 15..167 | 765 | 100 | Plus |
Blast to na_te.dros performed 2015-02-12 17:34:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3S18 | 6126 | 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). | 2585..2622 | 290..328 | 102 | 80 | Plus |
BO16859.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:58:03 Download gff for
BO16859.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14298-PA | 1..336 | 17..352 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 02:38:15 Download gff for
BO16859.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14298-RA | 76..410 | 15..349 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 19:44:35 Download gff for
BO16859.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14298-RA | 76..410 | 15..349 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 19:44:35 Download gff for
BO16859.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18876738..18876919 | 168..349 | 100 | | Plus |
3R | 18875783..18875935 | 15..167 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 02:38:15 Download gff for
BO16859.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 14701505..14701657 | 15..167 | 100 | -> | Plus |
arm_3R | 14702460..14702641 | 168..349 | 100 | | Plus |
BO16859.pep Sequence
Translation from 16 to 367
> BO16859.pep
MKLKINLTFLRATLVGLLSIILLTQTAHIEAFGSGGSSSGNGAVVSCKEL
NNFNCYVGRNEGNFCSRKDQTKVVTRWYFDKGVCKPFNYKGCNGNRNRFC
SQESCDARCGDASFLDH
BO16859.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:06:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14298-PB | 111 | CG14298-PB | 1..111 | 1..111 | 604 | 100 | Plus |
CG14298-PA | 111 | CG14298-PA | 1..111 | 1..111 | 604 | 100 | Plus |