Clone BO16859 Report

Search the DGRC for BO16859

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:168
Well:59
Vector:pDNR-Dual
Associated Gene/TranscriptCG14298-RA
Protein status:BO16859.pep: Imported from assembly
Sequenced Size:367

Clone Sequence Records

BO16859.complete Sequence

367 bp assembled on 2008-11-10

GenBank Submission: KX798661

> BO16859.complete
GAAGTTATCAGTCGACATGAAATTGAAAATCAATCTGACGTTCCTCCGTG
CGACACTCGTCGGTCTCCTGTCCATCATCCTCCTGACACAGACCGCGCAT
ATCGAGGCCTTTGGAAGCGGAGGCAGCTCTTCTGGCAATGGGGCAGTGGT
GTCGTGCAAAGAGCTGAACAATTTCAACTGCTATGTGGGCCGCAACGAGG
GTAACTTTTGCAGCAGGAAGGATCAGACCAAGGTCGTTACACGCTGGTAC
TTCGACAAGGGCGTCTGCAAGCCCTTCAACTATAAAGGATGCAACGGCAA
TCGCAATCGCTTCTGCTCGCAGGAAAGCTGCGATGCACGCTGCGGCGATG
CAAGCTTTCTAGACCAT

BO16859.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG14298-RB 336 CG14298-PB 1..333 17..349 1665 100 Plus
CG14298-RA 336 CG14298-PA 1..333 17..349 1665 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:06:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG14298-RB 875 CG14298-RB 256..590 15..349 1675 100 Plus
CG14298-RA 695 CG14298-RA 76..410 15..349 1675 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18876738..18876919 168..349 910 100 Plus
3R 32079331 3R 18875783..18875935 15..167 765 100 Plus
Blast to na_te.dros performed 2014-11-27 14:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
3S18 6126 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). 2585..2622 290..328 102 80 Plus

BO16859.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:17:32 Download gff for BO16859.complete
Subject Subject Range Query Range Percent Splice Strand
CG14298-RA 76..410 15..349 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:46 Download gff for BO16859.complete
Subject Subject Range Query Range Percent Splice Strand
CG14298-RA 78..410 17..351 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:26:56 Download gff for BO16859.complete
Subject Subject Range Query Range Percent Splice Strand
CG14298-RA 78..410 17..351 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:03:24 Download gff for BO16859.complete
Subject Subject Range Query Range Percent Splice Strand
CG14298-RA 78..410 17..351 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:03:24 Download gff for BO16859.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18875785..18875935 17..167 100 -> Plus
3R 18876738..18876919 168..351 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:46 Download gff for BO16859.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14701507..14701657 17..167 100 -> Plus
arm_3R 14702460..14702641 168..351 98   Plus

BO16859.5prime Sequence

365 bp (365 high quality bases) assembled on 2006-10-13

> BO16859.5prime
GAAGTTATCAGTCGACATGAAATTGAAAATCAATCTGACGTTCCTCCGTG
CGACACTCGTCGGTCTCCTGTCCATCATCCTCCTGACACAGACCGCGCAT
ATCGAGGCCTTTGGAAGCGGAGGCAGCTCTTCTGGCAATGGGGCAGTGGT
GTCGTGCAAAGAGCTGAACAATTTCAACTGCTATGTGGGCCGCAACGAGG
GTAACTTTTGCAGCAGGAAGGATCAGACCAAGGTCGTTACACGCTGGTAC
TTCGACAAGGGCGTCTGCAAGCCCTTCAACTATAAAGGATGCAACGGCAA
TCGCAATCGCTTCTGCTCGCAGGAAAGCTGCGATGCACGCTGCGGCGATG
CAAGCTTTCTAGACC

BO16859.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 16:41:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG14298-PA 336 CG14298-RA 1..333 17..349 1665 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 17:34:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG14298-RB 875 CG14298-RB 256..590 15..349 1675 100 Plus
CG14298-RA 695 CG14298-RA 76..410 15..349 1675 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 17:34:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18876738..18876919 168..349 910 100 Plus
3R 32079331 3R 18875783..18875935 15..167 765 100 Plus
Blast to na_te.dros performed 2015-02-12 17:34:48
Subject Length Description Subject Range Query Range Score Percent Strand
3S18 6126 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). 2585..2622 290..328 102 80 Plus

BO16859.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:58:03 Download gff for BO16859.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14298-PA 1..336 17..352 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 02:38:15 Download gff for BO16859.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14298-RA 76..410 15..349 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 19:44:35 Download gff for BO16859.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14298-RA 76..410 15..349 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 19:44:35 Download gff for BO16859.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 18876738..18876919 168..349 100   Plus
3R 18875783..18875935 15..167 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 02:38:15 Download gff for BO16859.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14701505..14701657 15..167 100 -> Plus
arm_3R 14702460..14702641 168..349 100   Plus

BO16859.pep Sequence

Translation from 16 to 367

> BO16859.pep
MKLKINLTFLRATLVGLLSIILLTQTAHIEAFGSGGSSSGNGAVVSCKEL
NNFNCYVGRNEGNFCSRKDQTKVVTRWYFDKGVCKPFNYKGCNGNRNRFC
SQESCDARCGDASFLDH

BO16859.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG14298-PB 111 CG14298-PB 1..111 1..111 604 100 Plus
CG14298-PA 111 CG14298-PA 1..111 1..111 604 100 Plus