Clone BO16868 Report

Search the DGRC for BO16868

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:168
Well:68
Vector:pDNR-Dual
Associated Gene/TranscriptCG17856-RA
Protein status:BO16868.pep: validated full length
Sequenced Size:367

Clone Sequence Records

BO16868.3prime Sequence

365 bp (365 high quality bases) assembled on 2006-10-13

> BO16868.3prime
ATGGTCTAGAAAGCTTGCATGAGTTTTGCTCCATTCCTCACGCTCTTCGC
GCTCCTTTTGCACTTCGTTAAGATAGGGCTCCAAGTACTTGATGTCCTCC
TCGTACTTGGTCCACTGCTCCTTGGGCAGGATCGTCTTGGTCATGGAAAG
GTGCAGTGCTCGAAGAATGCGATAGTTGCGTTCATCGTACAGTTTGCGGG
GCAGACGACGCACTGCTTCTGCCACATCCTCATTCTCGTACAGACAGTCA
TCGCGATACAGGCCGTATTGGTTGAATCCAGACATGTTGTAGGCCCACTT
TCCCAACTTGGAGAAAACCGCTGGGCCCACTCTAGCCACATATTTCGACA
TGTCGACTGATAACT

BO16868.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:10:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG17856-PA 336 CG17856-RA 1..333 351..19 1665 100 Minus
CG3560-PA 336 CG3560-RA 205..266 147..86 235 95.1 Minus
CG3560-PA 336 CG3560-RA 73..129 279..223 160 91.2 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG17856-RA 503 CG17856-RA 86..419 352..19 1670 100 Minus
CG3560-RA 523 CG3560-RA 122..443 352..31 650 80.1 Minus
CG32576-RA 1709 CG32576-RA 754..984 31..261 510 81.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 09:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 28294133..28294466 352..19 1670 100 Minus
X 23542271 X 16286678..16286908 261..31 510 81.4 Minus
Blast to na_te.dros performed 2015-02-11 09:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 4959..5027 49..119 106 66.7 Plus

BO16868.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:58:17 Download gff for BO16868.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17856-PA 1..336 16..351 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 17:01:43 Download gff for BO16868.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 86..419 19..352 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 11:14:07 Download gff for BO16868.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 86..419 19..352 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 11:14:07 Download gff for BO16868.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 28294133..28294466 19..352 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 17:01:43 Download gff for BO16868.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24119855..24120188 19..352 100   Minus

BO16868.5prime Sequence

365 bp (365 high quality bases) assembled on 2006-10-13

> BO16868.5prime
GAAGTTATCAGTCGACATGTCGAAATATGTGGCTAGAGTGGGCCCAGCGG
TTTTCTCCAAGTTGGGAAAGTGGGCCTACAACATGTCTGGATTCAACCAA
TACGGCCTGTATCGCGATGACTGTCTGTACGAGAATGAGGATGTGGCAGA
AGCAGTGCGTCGTCTGCCCCGCAAACTGTACGATGAACGCAACTATCGCA
TTCTTCGAGCACTGCACCTTTCCATGACCAAGACGATCCTGCCCAAGGAG
CAGTGGACCAAGTACGAGGAGGACATCAAGTACTTGGAGCCCTATCTTAA
CGAAGTGCAAAAGGAGCGCGAAGAGCGTGAGGAATGGAGCAAAACTCATG
CAAGCTTTCTAGACC

BO16868.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG17856-PA 336 CG17856-RA 1..333 17..349 1665 100 Plus
CG3560-PA 336 CG3560-RA 205..266 221..282 235 95.1 Plus
CG3560-PA 336 CG3560-RA 73..129 89..145 160 91.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:32:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG17856-RA 503 CG17856-RA 86..419 16..349 1670 100 Plus
CG3560-RA 523 CG3560-RA 122..443 16..337 650 80.1 Plus
CG32576-RA 1709 CG32576-RA 754..984 337..107 510 81.4 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:32:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 28294133..28294466 16..349 1670 100 Plus
X 23542271 X 16286678..16286908 107..337 510 81.4 Plus
Blast to na_te.dros performed 2015-02-11 17:32:40
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 4959..5027 319..249 106 66.7 Minus

BO16868.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:58:18 Download gff for BO16868.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17856-PA 1..336 17..352 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 10:22:42 Download gff for BO16868.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 86..419 16..349 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:15:35 Download gff for BO16868.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 86..419 16..349 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:15:35 Download gff for BO16868.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 28294133..28294466 16..349 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 10:22:42 Download gff for BO16868.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24119855..24120188 16..349 100   Plus

BO16868.complete Sequence

367 bp assembled on 2006-10-11

GenBank Submission: FJ633954

> BO16868.complete
GAAGTTATCAGTCGACATGTCGAAATATGTGGCTAGAGTGGGCCCAGCGG
TTTTCTCCAAGTTGGGAAAGTGGGCCTACAACATGTCTGGATTCAACCAA
TACGGCCTGTATCGCGATGACTGTCTGTACGAGAATGAGGATGTGGCAGA
AGCAGTGCGTCGTCTGCCCCGCAAACTGTACGATGAACGCAACTATCGCA
TTCTTCGAGCACTGCACCTTTCCATGACCAAGACGATCCTGCCCAAGGAG
CAGTGGACCAAGTACGAGGAGGACATCAAGTACTTGGAGCCCTATCTTAA
CGAAGTGCAAAAGGAGCGCGAAGAGCGTGAGGAATGGAGCAAAACTCATG
CAAGCTTTCTAGACCAT

BO16868.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:04:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG17856-RA 336 CG17856-PA 1..333 17..349 1665 100 Plus
CG3560-RA 336 CG3560-PA 1..321 17..337 645 80.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:04:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG17856-RA 503 CG17856-RA 86..419 16..349 1670 100 Plus
CG3560-RA 523 CG3560-RA 122..443 16..337 650 80.1 Plus
CG32576-RA 1709 CG32576-RA 754..984 337..107 510 81.4 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:04:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 28294133..28294466 16..349 1670 100 Plus
X 23542271 X 16286678..16286908 107..337 510 81.4 Plus
Blast to na_te.dros performed 2014-11-27 11:04:01
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 4959..5027 319..249 106 66.7 Minus

BO16868.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:05:29 Download gff for BO16868.complete
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 1..336 17..352 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:20:26 Download gff for BO16868.complete
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 1..336 17..352 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:23:32 Download gff for BO16868.complete
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 87..419 17..351 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:05:29 Download gff for BO16868.complete
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 1..336 17..352 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:38:00 Download gff for BO16868.complete
Subject Subject Range Query Range Percent Splice Strand
CG17856-RA 87..419 17..351 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:38:00 Download gff for BO16868.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28294134..28294466 17..351 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:23:32 Download gff for BO16868.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24119856..24120188 17..351 99   Plus

BO16868.pep Sequence

Translation from 16 to 367

> BO16868.pep
MSKYVARVGPAVFSKLGKWAYNMSGFNQYGLYRDDCLYENEDVAEAVRRL
PRKLYDERNYRILRALHLSMTKTILPKEQWTKYEEDIKYLEPYLNEVQKE
REEREEWSKTHASFLDH

BO16868.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:47:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG17856-PA 111 CG17856-PA 1..111 1..111 596 100 Plus
CG3560-PA 111 CG3560-PA 1..111 1..111 528 85.6 Plus