Clone BO16872 Report

Search the DGRC for BO16872

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:168
Well:72
Vector:pDNR-Dual
Associated Gene/TranscriptCG30093-RA
Protein status:BO16872.pep: validated full length
Sequenced Size:316

Clone Sequence Records

BO16872.5prime Sequence

314 bp (314 high quality bases) assembled on 2006-10-13

> BO16872.5prime
GAAGTTATCAGTCGACATGCCGATCTTTGATATCCGGCTTATGGGCAATA
TGCCCGCCAATACCGCTGGTCTGTGGAAGCGTGTCACCTTCCTGCTGGCC
CTACCGGCCATCGTCCTGTGCGCCGCAAACGCCTTCACCGGACACAAGCA
CGTGGAGCGGGAGCCGTTCGCCAAGTACGAGTACCTGAGGCGGCGGACCA
AACGATTCCCATGGGGAGATGGCAATCGCAGTTTGTTTCACAATGCCGAG
GTGAATGCCCTGCCCGAGGGCTACGAGGATGAGGTGGCTGAGGAGGATGC
AAGCTTTCTAGACC

BO16872.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:10:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG30093-PA 285 CG30093-RA 1..282 17..298 1410 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG30093-RA 540 CG30093-RA 85..368 15..298 1420 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:08:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15944112..15944395 15..298 1420 100 Plus
Blast to na_te.dros performed on 2015-02-12 11:08:42 has no hits.

BO16872.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:58:25 Download gff for BO16872.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30093-PA 1..285 17..302 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:44:49 Download gff for BO16872.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30093-RA 80..371 9..302 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:25:57 Download gff for BO16872.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30093-RA 80..371 9..302 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:25:57 Download gff for BO16872.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 15944107..15944398 9..302 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:44:49 Download gff for BO16872.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11831612..11831903 9..302 98   Plus

BO16872.3prime Sequence

314 bp (314 high quality bases) assembled on 2006-10-13

> BO16872.3prime
ATGGTCTAGAAAGCTTGCATCCTCCTCAGCCACCTCATCCTCGTAGCCCT
CGGGCAGGGCATTCACCTCGGCATTGTGAAACAAACTGCGATTGCCATCT
CCCCATGGGAATCGTTTGGTCCGCCGCCTCAGGTACTCGTACTTGGCGAA
CGGCTCCCGCTCCACGTGCTTGTGTCCGGTGAAGGCGTTTGCGGCGCACA
GGACGATGGCCGGTAGGGCCAGCAGGAAGGTGACACGCTTCCACAGACCA
GCGGTATTGGCGGGCATATTGCCCATAAGCCGGATATCAAAGATCGGCAT
GTCGACTGATAACT

BO16872.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:10:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG30093-PA 285 CG30093-RA 1..282 300..19 1410 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:09:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG30093-RA 540 CG30093-RA 85..368 302..19 1420 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:09:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15944112..15944395 302..19 1420 100 Minus
Blast to na_te.dros performed on 2015-02-10 16:09:27 has no hits.

BO16872.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:58:23 Download gff for BO16872.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30093-PA 1..285 15..300 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-19 20:11:13 Download gff for BO16872.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30093-RA 80..371 15..308 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:43:40 Download gff for BO16872.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30093-RA 80..371 15..308 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:43:40 Download gff for BO16872.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 15944107..15944398 15..308 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 20:11:13 Download gff for BO16872.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11831612..11831903 15..308 98   Minus

BO16872.complete Sequence

316 bp assembled on 2006-10-11

GenBank Submission: FJ633957

> BO16872.complete
GAAGTTATCAGTCGACATGCCGATCTTTGATATCCGGCTTATGGGCAATA
TGCCCGCCAATACCGCTGGTCTGTGGAAGCGTGTCACCTTCCTGCTGGCC
CTACCGGCCATCGTCCTGTGCGCCGCAAACGCCTTCACCGGACACAAGCA
CGTGGAGCGGGAGCCGTTCGCCAAGTACGAGTACCTGAGGCGGCGGACCA
AACGATTCCCATGGGGAGATGGCAATCGCAGTTTGTTTCACAATGCCGAG
GTGAATGCCCTGCCCGAGGGCTACGAGGATGAGGTGGCTGAGGAGGATGC
AAGCTTTCTAGACCAT

BO16872.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG30093-RA 285 CG30093-PA 1..282 17..298 1410 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:58:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG30093-RA 540 CG30093-RA 85..368 15..298 1420 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:58:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15944112..15944395 15..298 1420 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:58:08 has no hits.

BO16872.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:05:05 Download gff for BO16872.complete
Subject Subject Range Query Range Percent Splice Strand
CG30093-RA 1..285 17..302 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:19:47 Download gff for BO16872.complete
Subject Subject Range Query Range Percent Splice Strand
CG30093-RA 65..356 9..302 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:00:43 Download gff for BO16872.complete
Subject Subject Range Query Range Percent Splice Strand
CG30093-RA 87..368 17..300 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:05:05 Download gff for BO16872.complete
Subject Subject Range Query Range Percent Splice Strand
CG30093-RA 65..356 9..302 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:59:23 Download gff for BO16872.complete
Subject Subject Range Query Range Percent Splice Strand
CG30093-RA 87..368 17..300 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:59:23 Download gff for BO16872.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15944114..15944395 17..300 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:00:43 Download gff for BO16872.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11831619..11831900 17..300 99   Plus

BO16872.pep Sequence

Translation from 16 to 316

> BO16872.pep
MPIFDIRLMGNMPANTAGLWKRVTFLLALPAIVLCAANAFTGHKHVEREP
FAKYEYLRRRTKRFPWGDGNRSLFHNAEVNALPEGYEDEVAEEDASFLDH

BO16872.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG30093-PA 94 CG30093-PA 1..94 1..94 506 100 Plus
levy-PB 109 CG17280-PB 37..108 19..87 234 56.9 Plus
levy-PA 109 CG17280-PA 37..108 19..87 234 56.9 Plus
CG14077-PB 289 CG14077-PB 155..234 14..92 168 43.8 Plus
CG14077-PC 289 CG14077-PC 155..234 14..92 168 43.8 Plus