Clone Sequence Records
BO16873.3prime Sequence
290 bp (290 high quality bases) assembled on 2006-10-13
> BO16873.3prime
ATGGTCTAGAAAGCTTGCTTTGAGTTTCGAGAAGAGACTGTGAGCAACGC
AATGATCCAATTCAGCGACGAAGTCGAACAATTCCTCCATGCATGTCTCA
GTGGTTTTGGACTTGCCATTCACACGATCATTGCACTCTTGATACTTGTT
GTACAGGGACGCAATGTGACCTTTGGCCTGGCACTTCTCCCTAAGGGCTG
CTTGCGGATCAACTAACTCCTTTTCGTCATCATCGGCCTTGAGGACAGGC
ACCAAAACCCGGCTATTAAACGCCATGTCGACTGATAACT
BO16873.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:10:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30354-PA | 261 | CG30354-RA | 1..258 | 276..19 | 1290 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:41:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30354-RB | 443 | CG30354-RB | 117..374 | 276..19 | 1290 | 100 | Minus |
CG30354-RA | 387 | CG30354-RA | 61..318 | 276..19 | 1290 | 100 | Minus |
Ucrh-RD | 506 | CG41623-RD | 136..333 | 232..35 | 435 | 81.9 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:41:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8677335..8677592 | 276..19 | 1290 | 100 | Minus |
3L | 28110227 | 3L | 25121043..25121198 | 190..35 | 345 | 81.4 | Minus |
Blast to na_te.dros performed on 2015-02-10 17:41:03 has no hits.
BO16873.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:58:26 Download gff for
BO16873.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30354-PA | 1..261 | 18..276 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:42:12 Download gff for
BO16873.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30354-RA | 57..325 | 9..283 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:59:12 Download gff for
BO16873.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30354-RA | 57..325 | 9..283 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:59:12 Download gff for
BO16873.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8677331..8677594 | 17..283 | 98 | -> | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:42:12 Download gff for
BO16873.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4564836..4565099 | 17..283 | 98 | -> | Minus |
BO16873.5prime Sequence
290 bp (290 high quality bases) assembled on 2006-10-13
> BO16873.5prime
GAAGTTATCAGTCGACATGGCGTTTAATAGCCGGGTTTTGGTGCCTGTCC
TCAAGGCCGATGATGACGAAAAGGAGTTAGTTGATCCGCAAGCAGCCCTT
AGGGAGAAGTGCCAGGCCAAAGGTCACATTGCGTCCCTGTACAACAAGTA
TCAAGAGTGCAATGATCGTGTGAATGGCAAGTCCAAAACCACTGAGACAT
GCATGGAGGAATTGTTCGACTTCGTCGCTGAATTGGATCATTGCGTTGCT
CACAGTCTCTTCTCGAAACTCAAAGCAAGCTTTCTAGACC
BO16873.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:10:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30354-PA | 261 | CG30354-RA | 1..258 | 17..274 | 1290 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 03:54:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30354-RB | 443 | CG30354-RB | 117..374 | 17..274 | 1290 | 100 | Plus |
CG30354-RA | 387 | CG30354-RA | 61..318 | 17..274 | 1290 | 100 | Plus |
Ucrh-RD | 506 | CG41623-RD | 136..333 | 61..258 | 435 | 81.9 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 03:54:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8677335..8677592 | 17..274 | 1290 | 100 | Plus |
3L | 28110227 | 3L | 25121043..25121198 | 103..258 | 345 | 81.4 | Plus |
Blast to na_te.dros performed on 2015-02-12 03:54:57 has no hits.
BO16873.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:58:27 Download gff for
BO16873.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30354-PA | 1..261 | 17..275 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 21:32:01 Download gff for
BO16873.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30354-RA | 57..325 | 10..284 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:50:05 Download gff for
BO16873.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30354-RA | 57..325 | 10..284 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 06:50:05 Download gff for
BO16873.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8677331..8677594 | 10..276 | 98 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 21:32:01 Download gff for
BO16873.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4564836..4565099 | 10..276 | 98 | -> | Plus |
BO16873.complete Sequence
292 bp assembled on 2006-10-11
GenBank Submission: FJ633958
> BO16873.complete
GAAGTTATCAGTCGACATGGCGTTTAATAGCCGGGTTTTGGTGCCTGTCC
TCAAGGCCGATGATGACGAAAAGGAGTTAGTTGATCCGCAAGCAGCCCTT
AGGGAGAAGTGCCAGGCCAAAGGTCACATTGCGTCCCTGTACAACAAGTA
TCAAGAGTGCAATGATCGTGTGAATGGCAAGTCCAAAACCACTGAGACAT
GCATGGAGGAATTGTTCGACTTCGTCGCTGAATTGGATCATTGCGTTGCT
CACAGTCTCTTCTCGAAACTCAAAGCAAGCTTTCTAGACCAT
BO16873.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:43:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30354-RB | 261 | CG30354-PB | 1..258 | 17..274 | 1290 | 100 | Plus |
CG30354-RA | 261 | CG30354-PA | 1..258 | 17..274 | 1290 | 100 | Plus |
Ucrh-RD | 258 | CG41623-PD | 42..239 | 61..258 | 435 | 81.3 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:43:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30354-RB | 443 | CG30354-RB | 117..374 | 17..274 | 1290 | 100 | Plus |
CG30354-RA | 387 | CG30354-RA | 61..318 | 17..274 | 1290 | 100 | Plus |
Ucrh-RD | 506 | CG41623-RD | 136..333 | 61..258 | 435 | 81.3 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:43:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8677335..8677592 | 17..274 | 1290 | 100 | Plus |
3L | 28110227 | 3L | 25121043..25121198 | 103..258 | 345 | 81.4 | Plus |
Blast to na_te.dros performed on 2014-11-27 14:43:12 has no hits.
BO16873.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:50 Download gff for
BO16873.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30354-RA | 1..261 | 17..275 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:19:26 Download gff for
BO16873.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30354-RA | 5..273 | 10..284 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:44:32 Download gff for
BO16873.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30354-RA | 61..318 | 17..276 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:50 Download gff for
BO16873.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30354-RA | 5..273 | 10..284 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:51:21 Download gff for
BO16873.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30354-RA | 61..318 | 17..276 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:51:21 Download gff for
BO16873.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8677335..8677592 | 17..276 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:44:32 Download gff for
BO16873.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4564840..4565097 | 17..276 | 99 | | Plus |
BO16873.pep Sequence
Translation from 16 to 292
> BO16873.pep
MAFNSRVLVPVLKADDDEKELVDPQAALREKCQAKGHIASLYNKYQECND
RVNGKSKTTETCMEELFDFVAELDHCVAHSLFSKLKASFLDH
BO16873.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:47:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30354-PB | 86 | CG30354-PB | 1..86 | 1..86 | 450 | 100 | Plus |
CG30354-PA | 86 | CG30354-PA | 1..86 | 1..86 | 450 | 100 | Plus |
Ucrh-PD | 85 | CG41623-PD | 1..85 | 1..86 | 360 | 77.9 | Plus |
Ucrh-PC | 85 | CG41623-PC | 1..85 | 1..86 | 360 | 77.9 | Plus |
Ucrh-PB | 85 | CG41623-PB | 1..85 | 1..86 | 360 | 77.9 | Plus |