Clone BO16879 Report

Search the DGRC for BO16879

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:168
Well:79
Vector:pDNR-Dual
Associated Gene/TranscriptHP6-RA
Protein status:BO16879.pep: validated full length
Sequenced Size:352

Clone Sequence Records

BO16879.3prime Sequence

350 bp (350 high quality bases) assembled on 2006-10-13

> BO16879.3prime
ATGGTCTAGAAAGCTTGCGGCATTTCGTGATCGTTTCTTCCTGGGACTCG
GAGTGGTCTCATACCCATTGTCCGACTCCAAGTCTTCTTCATCGCCCTCA
TCCGTGAACACAATACGCTCCTCGTAGAACGAGATGACCATTTGGGGGCA
CCGAACGTTGAGCACTTCGGCGGGCACCAGGCCGGCTTCGTCGCAACCCT
TCCACTGCATCAAAAAGGTCAGCTTACCGGACCAGTTGCAGGCTCCTAAG
ATCCGCAACGGTTCGAGTCCAAGATCAAATCCATTTCGTTGCTTCACCGG
AAGAGCAGTAGAGGACGTCAAAGTGGAGCTGGGCATGTCGACTGATAACT

BO16879.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:11:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG15636-PA 321 CG15636-RA 1..318 336..19 1590 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:09:41
Subject Length Description Subject Range Query Range Score Percent Strand
HP6-RA 500 CG15636-RA 116..433 336..19 1590 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 09:09:40
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4577786..4578103 19..336 1590 100 Plus
Blast to na_te.dros performed on 2015-02-11 09:09:41 has no hits.

BO16879.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:58:35 Download gff for BO16879.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15636-PA 1..321 18..336 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 17:01:58 Download gff for BO16879.3prime
Subject Subject Range Query Range Percent Splice Strand
HP6-RA 99..416 19..336 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 11:15:28 Download gff for BO16879.3prime
Subject Subject Range Query Range Percent Splice Strand
HP6-RA 116..433 19..336 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 11:15:28 Download gff for BO16879.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 4577786..4578103 19..336 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 17:01:58 Download gff for BO16879.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4577786..4578103 19..336 100   Plus

BO16879.5prime Sequence

350 bp (350 high quality bases) assembled on 2006-10-13

> BO16879.5prime
GAAGTTATCAGTCGACATGCCCAGCTCCACTTTGACGTCCTCTACTGCTC
TTCCGGTGAAGCAACGAAATGGATTTGATCTTGGACTCGAACCGTTGCGG
ATCTTAGGAGCCTGCAACTGGTCCGGTAAGCTGACCTTTTTGATGCAGTG
GAAGGGTTGCGACGAAGCCGGCCTGGTGCCCGCCGAAGTGCTCAACGTTC
GGTGCCCCCAAATGGTCATCTCGTTCTACGAGGAGCGTATTGTGTTCACG
GATGAGGGCGATGAAGAAGACTTGGAGTCGGACAATGGGTATGAGACCAC
TCCGAGTCCCAGGAAGAAACGATCACGAAATGCCGCAAGCTTTCTAGACC

BO16879.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:11:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG15636-PA 321 CG15636-RA 1..318 17..334 1590 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
HP6-RA 500 CG15636-RA 116..433 17..334 1590 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4577786..4578103 334..17 1590 100 Minus
Blast to na_te.dros performed on 2015-02-10 16:49:09 has no hits.

BO16879.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:58:35 Download gff for BO16879.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15636-PA 1..321 17..335 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 20:20:17 Download gff for BO16879.5prime
Subject Subject Range Query Range Percent Splice Strand
HP6-RA 99..416 17..334 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:05:03 Download gff for BO16879.5prime
Subject Subject Range Query Range Percent Splice Strand
HP6-RA 116..433 17..334 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:05:03 Download gff for BO16879.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 4577786..4578103 17..334 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 20:20:17 Download gff for BO16879.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4577786..4578103 17..334 100   Minus

BO16879.complete Sequence

352 bp assembled on 2006-10-11

GenBank Submission: FJ633963

> BO16879.complete
GAAGTTATCAGTCGACATGCCCAGCTCCACTTTGACGTCCTCTACTGCTC
TTCCGGTGAAGCAACGAAATGGATTTGATCTTGGACTCGAACCGTTGCGG
ATCTTAGGAGCCTGCAACTGGTCCGGTAAGCTGACCTTTTTGATGCAGTG
GAAGGGTTGCGACGAAGCCGGCCTGGTGCCCGCCGAAGTGCTCAACGTTC
GGTGCCCCCAAATGGTCATCTCGTTCTACGAGGAGCGTATTGTGTTCACG
GATGAGGGCGATGAAGAAGACTTGGAGTCGGACAATGGGTATGAGACCAC
TCCGAGTCCCAGGAAGAAACGATCACGAAATGCCGCAAGCTTTCTAGACC
AT

BO16879.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:50:30
Subject Length Description Subject Range Query Range Score Percent Strand
HP6-RA 321 CG15636-PA 1..318 17..334 1590 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:50:31
Subject Length Description Subject Range Query Range Score Percent Strand
HP6-RA 500 CG15636-RA 116..433 17..334 1590 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:50:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4577786..4578103 334..17 1590 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:50:29 has no hits.

BO16879.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:05:26 Download gff for BO16879.complete
Subject Subject Range Query Range Percent Splice Strand
Umbrea-RA 1..321 17..335 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:20:21 Download gff for BO16879.complete
Subject Subject Range Query Range Percent Splice Strand
Umbrea-RA 1..321 17..335 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:55:11 Download gff for BO16879.complete
Subject Subject Range Query Range Percent Splice Strand
HP6-RA 99..416 17..336 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:05:26 Download gff for BO16879.complete
Subject Subject Range Query Range Percent Splice Strand
Umbrea-RA 1..321 17..335 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:27:44 Download gff for BO16879.complete
Subject Subject Range Query Range Percent Splice Strand
HP6-RA 116..433 17..336 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:27:44 Download gff for BO16879.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4577784..4578103 17..336 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:55:11 Download gff for BO16879.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4577784..4578103 17..336 99   Minus

BO16879.pep Sequence

Translation from 16 to 352

> BO16879.pep
MPSSTLTSSTALPVKQRNGFDLGLEPLRILGACNWSGKLTFLMQWKGCDE
AGLVPAEVLNVRCPQMVISFYEERIVFTDEGDEEDLESDNGYETTPSPRK
KRSRNAASFLDH

BO16879.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:47:21
Subject Length Description Subject Range Query Range Score Percent Strand
HP6-PA 106 CG15636-PA 1..106 1..106 561 100 Plus
HP1b-PB 240 CG7041-PB 90..152 15..77 192 58.7 Plus
HP1b-PC 240 CG7041-PC 90..152 15..77 192 58.7 Plus
HP1b-PA 240 CG7041-PA 90..152 15..77 192 58.7 Plus
Su(var)205-PB 206 CG8409-PB 127..206 4..83 184 45 Plus