Clone BO16884 Report

Search the DGRC for BO16884

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:168
Well:84
Vector:pDNR-Dual
Associated Gene/TranscriptCG15369-RA
Protein status:BO16884.pep: validated full length
Sequenced Size:400

Clone Sequence Records

BO16884.3prime Sequence

399 bp (399 high quality bases) assembled on 2006-10-13

> BO16884.3prime
ATGGTCTAGAAAGCTTGCACCATCGTGTTTCCTGACCAGTTCTGGTTCAT
TTGGGCACCTGAAGGTCACCTGGATACCATTGGGAAGCCAGCTTTGCGAC
CAGATGTCCACTTGGCACACCTTGGTAGCACCCTGATTATCGATCAGCTC
CACAGAGTAATCATTCTTAAAGCCAGAGACCACCTGGGACGTTGCCGAAA
GAATTTTGGAGAGGCGATAGTGGGGTCCTTCGCCAGCAGCCAATTTGGTC
AAGGATGCCTCAAGCGTTTGCTGGGCACTGGCCAGATCCTCGCCTTCGAG
GACTTTTGGTGCACCGAGTCCAAACGGCGTGGCACTGACCAACACGCAGG
CGGTGCACAGGATTAGAATCTTGGCGAGAAACATGTCGACTGATAACTT

BO16884.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:11:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG15369-PA 369 CG15369-RA 1..364 384..21 1820 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG15369-RB 542 CG15369-RB 55..418 384..21 1820 100 Minus
CG15369-RA 444 CG15369-RA 55..418 384..21 1820 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:49:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9217148..9217342 215..21 975 100 Minus
X 23542271 X 9216926..9217095 384..215 850 100 Minus
Blast to na_te.dros performed on 2015-02-10 16:49:50 has no hits.

BO16884.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:58:43 Download gff for BO16884.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15369-PA 1..369 15..384 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 20:20:24 Download gff for BO16884.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15369-RA 55..423 15..384 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:05:08 Download gff for BO16884.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15369-RA 55..423 15..384 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:05:08 Download gff for BO16884.3prime
Subject Subject Range Query Range Percent Splice Strand
X 9216926..9217095 215..384 100 -> Minus
X 9217149..9217347 15..214 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 20:20:24 Download gff for BO16884.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 9110959..9111128 215..384 100 -> Minus
arm_X 9111182..9111380 15..214 98   Minus

BO16884.5prime Sequence

398 bp (398 high quality bases) assembled on 2006-10-13

> BO16884.5prime
GAAGTTATCAGTCGACATGTTTCTCGCCAAGATTCTAATCCTGTGCACCG
CCTGCGTGTTGGTCAGTGCCACGCCGTTTGGACTCGGTGCACCAAAAGTC
CTCGAAGGCGAGGATCTGGCCAGTGCCCAGCAAACGCTTGAGGCATCCTT
GACCAAATTGGCTGCTGGCGAAGGACCCCACTATCGCCTCTCCAAAATTC
TTTCGGCAACGTCCCAGGTGGTCTCTGGCTTTAAGAATGATTACTCTGTG
GAGCTGATCGATAATCAGGGTGCTACCAAGGTGTGCCAAGTGGACATCTG
GTCGCAAAGCTGGCTTCCCAATGGTATCCAGGTGACCTTCAGGTGCCCAA
ATGAACCAAAACTGGTCAGGAAACACGATGCTGCAAGCTTTCTAGACC

BO16884.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:11:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG15369-PA 369 CG15369-RA 1..366 17..382 1805 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG15369-RB 542 CG15369-RB 55..420 17..382 1815 99.7 Plus
CG15369-RA 444 CG15369-RA 55..420 17..382 1815 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:45:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9217148..9217344 186..382 970 99.5 Plus
X 23542271 X 9216926..9217095 17..186 850 100 Plus
Blast to na_te.dros performed on 2015-02-10 17:45:20 has no hits.

BO16884.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:58:43 Download gff for BO16884.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15369-PA 1..369 17..386 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:42:34 Download gff for BO16884.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15369-RA 55..423 17..386 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:59:46 Download gff for BO16884.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15369-RA 55..423 17..386 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:59:46 Download gff for BO16884.5prime
Subject Subject Range Query Range Percent Splice Strand
X 9216926..9217095 17..186 100 -> Plus
X 9217149..9217347 187..386 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:42:34 Download gff for BO16884.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 9110959..9111128 17..186 100 -> Plus
arm_X 9111182..9111380 187..386 98   Plus

BO16884.complete Sequence

400 bp assembled on 2006-10-11

GenBank Submission: FJ633967

> BO16884.complete
GAAGTTATCAGTCGACATGTTTCTCGCCAAGATTCTAATCCTGTGCACCG
CCTGCGTGTTGGTCAGTGCCACGCCGTTTGGACTCGGTGCACCAAAAGTC
CTCGAAGGCGAGGATCTGGCCAGTGCCCAGCAAACGCTTGAGGCATCCTT
GACCAAATTGGCTGCTGGCGAAGGACCCCACTATCGCCTCTCCAAAATTC
TTTCGGCAACGTCCCAGGTGGTCTCTGGCTTTAAGAATGATTACTCTGTG
GAGCTGATCGATAATCAGGGTGCTACCAAGGTGTGCCAAGTGGACATCTG
GTCGCAAAGCTGGCTTCCCAATGGTATCCAGGTGACCTTCAGGTGCCCAA
ATGAACCAGAACTGGTCAGGAAACACGATGCTGCAAGCTTTCTAGACCAT

BO16884.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:56:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG15369-RB 369 CG15369-PB 1..366 17..382 1830 100 Plus
CG15369-RA 369 CG15369-PA 1..366 17..382 1830 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:56:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG15369-RB 542 CG15369-RB 55..420 17..382 1830 100 Plus
CG15369-RA 444 CG15369-RA 55..420 17..382 1830 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:56:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9217148..9217344 186..382 985 100 Plus
X 23542271 X 9216926..9217095 17..186 850 100 Plus
Blast to na_te.dros performed on 2014-11-27 20:56:53 has no hits.

BO16884.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:05:50 Download gff for BO16884.complete
Subject Subject Range Query Range Percent Splice Strand
CG15369-RA 1..369 17..386 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:20:57 Download gff for BO16884.complete
Subject Subject Range Query Range Percent Splice Strand
CG15369-RA 34..402 17..386 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:15:57 Download gff for BO16884.complete
Subject Subject Range Query Range Percent Splice Strand
CG15369-RA 61..420 23..384 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:05:50 Download gff for BO16884.complete
Subject Subject Range Query Range Percent Splice Strand
CG15369-RA 34..402 17..386 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:31:37 Download gff for BO16884.complete
Subject Subject Range Query Range Percent Splice Strand
CG15369-RA 61..420 23..384 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:31:37 Download gff for BO16884.complete
Subject Subject Range Query Range Percent Splice Strand
X 9216932..9217095 23..186 100 -> Plus
X 9217149..9217344 187..384 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:15:57 Download gff for BO16884.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9110965..9111128 23..186 100 -> Plus
arm_X 9111182..9111377 187..384 98   Plus

BO16884.pep Sequence

Translation from 16 to 400

> BO16884.pep
MFLAKILILCTACVLVSATPFGLGAPKVLEGEDLASAQQTLEASLTKLAA
GEGPHYRLSKILSATSQVVSGFKNDYSVELIDNQGATKVCQVDIWSQSWL
PNGIQVTFRCPNEPELVRKHDAASFLDH

BO16884.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG15369-PB 122 CG15369-PB 1..122 1..122 628 100 Plus
CG15369-PA 122 CG15369-PA 1..122 1..122 628 100 Plus
CG31313-PB 124 CG31313-PB 7..120 6..116 188 37.4 Plus
CG31313-PA 124 CG31313-PA 7..120 6..116 188 37.4 Plus
Cys-PA 126 CG8050-PA 12..118 7..113 179 38 Plus