Clone BO16889 Report

Search the DGRC for BO16889

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:168
Well:89
Vector:pDNR-Dual
Associated Gene/TranscriptCG5693-RA
Protein status:BO16889.pep: validated full length
Sequenced Size:250

Clone Sequence Records

BO16889.3prime Sequence

248 bp (248 high quality bases) assembled on 2006-10-13

> BO16889.3prime
ATGGTCTAGAAAGCTTGCCTTCTGTTCCCGGAGCTTCGGTTCTTTTTGGG
CTTTCTGGTCCAGTGGTTGCTTCGCCGCGTCCTTGTTGGATTGTGGGGCG
GGATTGCATCGGGGTAGTTGGGACTCCGGGCAAACTCCGCACTCCGGAAC
CGTGCAGTGGCCCTCCTCCAAGCAATCGGGGTCACAGCAGGGCGGATCGG
GTCCAATGTAGCCCGGATTAAATATGCAAGGCATGTCGACTGATAACT

BO16889.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG5693-PA 219 CG5693-RA 1..216 234..19 1080 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG5693-RA 590 CG5693-RA 156..372 235..19 1085 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18006782..18006998 235..19 1085 100 Minus
Blast to na_te.dros performed on 2015-02-10 21:28:04 has no hits.

BO16889.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:58:49 Download gff for BO16889.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5693-PA 1..219 18..234 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 18:06:15 Download gff for BO16889.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 156..372 19..235 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:42:08 Download gff for BO16889.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 156..372 19..235 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:42:08 Download gff for BO16889.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 18006782..18007000 14..235 98 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 18:06:15 Download gff for BO16889.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18006782..18007000 14..235 98 -> Minus

BO16889.5prime Sequence

248 bp (248 high quality bases) assembled on 2006-10-13

> BO16889.5prime
GAAGTTATCAGTCGACATGCCTTGCATATTTAATCCGGGCTACATTGGAC
CCGATCCGCCCTGCTGTGACCCCGATTGCTTGGAGGAGGGCCACTGCACG
GTTCCGGAGTGCGGAGTTTGCCCGGAGTCCCAACTACCCCGATGCAATCC
CGCCCCACAATCCAACAAGGACGCGGCGAAGCAACCACTGGACCAGAAAG
CCCAAAAAGAACCGAAGCTCCGGGAACAGAAGGCAAGCTTTCTAGACC

BO16889.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG5693-PA 219 CG5693-RA 1..216 17..232 1080 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:50:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG5693-RA 590 CG5693-RA 156..372 16..232 1085 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:50:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18006782..18006998 16..232 1085 100 Plus
Blast to na_te.dros performed on 2015-02-10 16:50:29 has no hits.

BO16889.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:58:49 Download gff for BO16889.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5693-PA 1..219 17..233 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 20:20:30 Download gff for BO16889.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 156..372 16..232 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:05:14 Download gff for BO16889.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 156..372 16..232 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:05:14 Download gff for BO16889.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 18006782..18007000 16..237 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 20:20:30 Download gff for BO16889.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18006782..18007000 16..237 98 -> Plus

BO16889.complete Sequence

250 bp assembled on 2006-10-11

GenBank Submission: FJ633970

> BO16889.complete
GAAGTTATCAGTCGACATGCCTTGCATATTTAATCCGGGCTACATTGGAC
CCGATCCGCCCTGCTGTGACCCCGATTGCTTGGAGGAGGGCCACTGCACG
GTTCCGGAGTGCGGAGTTTGCCCGGAGTCCCAACTACCCCGATGCAATCC
CGCCCCACAATCCAACAAGGACGCGGCGAAGCAACCACTGGACCAGAAAG
CCCAAAAAGAACCGAAGCTCCGGGAACAGAAGGCAAGCTTTCTAGACCAT

BO16889.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:09:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG5693-RA 219 CG5693-PA 1..216 17..232 1080 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG5693-RA 590 CG5693-RA 156..372 16..232 1085 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:09:40
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18006782..18006998 16..232 1085 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:09:40 has no hits.

BO16889.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:40 Download gff for BO16889.complete
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 1..219 17..233 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:19:09 Download gff for BO16889.complete
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 104..320 16..232 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:07:16 Download gff for BO16889.complete
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 157..372 17..234 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:41 Download gff for BO16889.complete
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 104..320 16..232 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:04:34 Download gff for BO16889.complete
Subject Subject Range Query Range Percent Splice Strand
CG5693-RA 157..372 17..234 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:04:34 Download gff for BO16889.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18006783..18006998 17..234 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:07:16 Download gff for BO16889.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18006783..18006998 17..234 99   Plus

BO16889.pep Sequence

Translation from 16 to 250

> BO16889.pep
MPCIFNPGYIGPDPPCCDPDCLEEGHCTVPECGVCPESQLPRCNPAPQSN
KDAAKQPLDQKAQKEPKLREQKASFLDH

BO16889.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:38:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG5693-PA 72 CG5693-PA 1..72 1..72 422 100 Plus