Clone BO16901 Report

Search the DGRC for BO16901

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:169
Well:1
Vector:pDNR-Dual
Associated Gene/TranscriptCG32069-RA
Protein status:BO16901.pep: validated full length
Sequenced Size:274

Clone Sequence Records

BO16901.5prime Sequence

272 bp (272 high quality bases) assembled on 2006-10-13

> BO16901.5prime
GAAGTTATCAGTCGACATGTTTACTTTGTGGACACTGATTGAATCTTCAC
TCCTGTGCCTGAATGCGGTGTGCATTCTGCACGAGGAACGCTTTCTGGCC
AAGTTTGGCTGGGGACGACAGGCGGGCCAGCAGGACTTTGGAGCACCTAC
GGCCAAGGATCAGGTGCTAAACCTCATTCGTTCCATACGCACAGTGGCCA
AAATTCCCCTGATATTCCTTAACATAATTGCGATTATATTTAAACTATTA
CTTGGTGCAAGCTTTCTAGACC

BO16901.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:11:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG32069-PA 243 CG32069-RA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 10:25:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG32069-RA 356 CG32069-RA 72..311 17..256 1200 100 Plus
Blos2-RA 645 CG14145-RA 606..645 256..217 200 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 10:25:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11062291..11062389 203..105 495 100 Minus
3L 28110227 3L 11062456..11062543 104..17 440 100 Minus
3L 28110227 3L 11062176..11062228 256..204 265 100 Minus
Blast to na_te.dros performed on 2015-02-06 10:25:04 has no hits.

BO16901.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:59:00 Download gff for BO16901.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32069-PA 1..243 17..259 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 06:41:27 Download gff for BO16901.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 72..311 17..256 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:26:16 Download gff for BO16901.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 72..311 17..256 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:26:16 Download gff for BO16901.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 11062456..11062543 17..104 100   Minus
3L 11062176..11062228 204..256 100 <- Minus
3L 11062291..11062389 105..203 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 06:41:27 Download gff for BO16901.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11055276..11055328 204..256 100 <- Minus
arm_3L 11055391..11055489 105..203 100 <- Minus
arm_3L 11055556..11055643 17..104 100   Minus

BO16901.3prime Sequence

272 bp (272 high quality bases) assembled on 2006-10-13

> BO16901.3prime
ATGGTCTAGAAAGCTTGCACCAAGTAATAGTTTAAATATAATCGCAATTA
TGTTAAGGAATATCAGGGGAATTTTGGCCACTGTGCGTATGGAACGAATG
AGGTTTAGCACCTGATCCTTGGCCGTAGGTGCTCCAAAGTCCTGCTGGCC
CGCCTGTCGTCCCCAGCCAAACTTGGCCAGAAAGCGTTCCTCGTGCAGAA
TGCACACCGCATTCAGGCACAGGAGTGAAGATTCAATCAGTGTCCACAAA
GTAAACATGTCGACTGATAACT

BO16901.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:11:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG32069-PA 243 CG32069-RA 1..240 258..19 1200 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:10:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG32069-RA 356 CG32069-RA 72..311 258..19 1200 100 Minus
Blos2-RA 645 CG14145-RA 606..645 19..58 200 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11062291..11062389 72..170 495 100 Plus
3L 28110227 3L 11062456..11062543 171..258 440 100 Plus
3L 28110227 3L 11062176..11062228 19..71 265 100 Plus
Blast to na_te.dros performed on 2015-02-12 11:10:07 has no hits.

BO16901.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:58:59 Download gff for BO16901.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32069-PA 1..243 16..258 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:45:10 Download gff for BO16901.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 72..311 19..258 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:28:50 Download gff for BO16901.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 72..311 19..258 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:28:50 Download gff for BO16901.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 11062176..11062228 19..71 100 <- Plus
3L 11062291..11062389 72..170 100 <- Plus
3L 11062456..11062543 171..258 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:45:10 Download gff for BO16901.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11055276..11055328 19..71 100 <- Plus
arm_3L 11055391..11055489 72..170 100 <- Plus
arm_3L 11055556..11055643 171..258 100   Plus

BO16901.complete Sequence

274 bp assembled on 2006-10-11

GenBank Submission: FJ633974

> BO16901.complete
GAAGTTATCAGTCGACATGTTTACTTTGTGGACACTGATTGAATCTTCAC
TCCTGTGCCTGAATGCGGTGTGCATTCTGCACGAGGAACGCTTTCTGGCC
AAGTTTGGCTGGGGACGACAGGCGGGCCAGCAGGACTTTGGAGCACCTAC
GGCCAAGGATCAGGTGCTAAACCTCATTCGTTCCATACGCACAGTGGCCA
AAATTCCCCTGATATTCCTTAACATAATTGCGATTATATTTAAACTATTA
CTTGGTGCAAGCTTTCTAGACCAT

BO16901.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:24:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG32069-RA 243 CG32069-PA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:24:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG32069-RA 356 CG32069-RA 72..311 17..256 1200 100 Plus
Blos2-RA 645 CG14145-RA 606..645 256..217 200 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:24:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11062291..11062389 203..105 495 100 Minus
3L 28110227 3L 11062456..11062543 104..17 440 100 Minus
3L 28110227 3L 11062176..11062228 256..204 265 100 Minus
Blast to na_te.dros performed on 2014-11-27 20:24:41 has no hits.

BO16901.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:47 Download gff for BO16901.complete
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 1..243 17..259 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:19:21 Download gff for BO16901.complete
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 72..311 17..256 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:09:44 Download gff for BO16901.complete
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 78..311 23..258 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:47 Download gff for BO16901.complete
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 1..243 17..259 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:20:53 Download gff for BO16901.complete
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 78..311 23..258 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:20:53 Download gff for BO16901.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11062172..11062228 204..258 96 <- Minus
3L 11062291..11062389 105..203 100 <- Minus
3L 11062456..11062537 23..104 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:09:44 Download gff for BO16901.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11055272..11055328 204..258 96 <- Minus
arm_3L 11055391..11055489 105..203 100 <- Minus
arm_3L 11055556..11055637 23..104 100   Minus

BO16901.pep Sequence

Translation from 16 to 274

> BO16901.pep
MFTLWTLIESSLLCLNAVCILHEERFLAKFGWGRQAGQQDFGAPTAKDQV
LNLIRSIRTVAKIPLIFLNIIAIIFKLLLGASFLDH

BO16901.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:22:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG32069-PA 80 CG32069-PA 1..80 1..80 406 100 Plus