Clone BO16903 Report

Search the DGRC for BO16903

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:169
Well:3
Vector:pDNR-Dual
Associated Gene/TranscriptCG3513-RA
Protein status:BO16903.pep: validated full length
Sequenced Size:298

Clone Sequence Records

BO16903.3prime Sequence

296 bp (296 high quality bases) assembled on 2006-10-13

> BO16903.3prime
ATGGTCTAGAAAGCTTGCGTCCTTGCAGGCCTTTTCGCATTCACTCTTGG
TAGAGAACTGATTGGAGTTTCCACCGCAGCCACCGAAAATGAACTCGGTG
CAGGCGTTTTTGGAGGCATCATAGGTCCAGGCCGGCATAAAAGCCATGCA
GGCAGCTCCATCCTGCGCCATGCCCACCATCGAAGAGGGCTGCTGGCACA
TCTCCGGCTTGGCATGCACCCATAAACGACTGCCGGACAGACTCAGCAAA
AAGGCGATGGCGACAAAGCCGATATACTTCATGTCGACTGATAACT

BO16903.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:11:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG3513-PA 267 CG3513-RA 1..264 282..19 1320 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-31 10:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG3513-RA 423 CG3513-RA 15..278 282..19 1320 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-01-31 10:12:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3692844..3693029 19..204 930 100 Plus
2L 23513712 2L 3693090..3693168 204..282 395 100 Plus
Blast to na_te.dros performed on 2015-01-31 10:12:19 has no hits.

BO16903.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:59:02 Download gff for BO16903.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3513-PA 1..267 15..282 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 23:34:58 Download gff for BO16903.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3513-RA 2..283 14..296 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-31 12:44:17 Download gff for BO16903.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3513-RA 2..283 14..296 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-31 12:44:17 Download gff for BO16903.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 3693090..3693181 204..296 94   Plus
2L 3692845..3693028 20..203 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 23:34:58 Download gff for BO16903.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3692845..3693028 20..203 100 <- Plus
arm_2L 3693090..3693181 204..296 94   Plus

BO16903.5prime Sequence

296 bp (296 high quality bases) assembled on 2006-10-13

> BO16903.5prime
GAAGTTATCAGTCGACATGAAGTATATCGGCTTTGTCGCCATCGCCTTTT
TGCTGAGTCTGTCCGGCAGTCGTTTATGGGTGCATGCCAAGCCGGAGATG
TGCCAGCAGCCCTCTTCGATGGTGGGCATGGCGCAGGATGGAGCTGCCTG
CATGGCTTTTATGCCGGCCTGGACCTATGATGCCTCCAAAAACGCCTGCA
CCGAGTTCATTTTCGGTGGCTGCGGTGGAAACTCCAATCAGTTCTCTACC
AAGAGTGAATGCGAAAAGGCCTGCAAGGACGCAAGCTTTCTAGACC

BO16903.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:11:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG3513-PA 267 CG3513-RA 1..264 17..280 1320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 10:25:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG3513-RA 423 CG3513-RA 15..278 17..280 1320 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 10:25:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3692844..3693029 280..95 930 100 Minus
2L 23513712 2L 3693090..3693168 95..17 395 100 Minus
Blast to na_te.dros performed on 2015-02-06 10:25:17 has no hits.

BO16903.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:59:03 Download gff for BO16903.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3513-PA 1..267 17..284 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 06:41:28 Download gff for BO16903.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3513-RA 1..283 2..285 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:26:18 Download gff for BO16903.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3513-RA 1..283 2..285 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:26:18 Download gff for BO16903.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 3692845..3693028 96..279 100 <- Minus
2L 3693090..3693183 1..95 94   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 06:41:28 Download gff for BO16903.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3693090..3693183 1..95 94   Minus
arm_2L 3692845..3693028 96..279 100 <- Minus

BO16903.complete Sequence

298 bp assembled on 2006-10-11

GenBank Submission: FJ633975

> BO16903.complete
GAAGTTATCAGTCGACATGAAGTATATCGGCTTTGTCGCCATCGCCTTTT
TGCTGAGTCTGTCCGGCAGTCGTTTATGGGTGCATGCCAAGCCGGAGATG
TGCCAGCAGCCCTCTTCGATGGTGGGCATGGCGCAGGATGGAGCTGCCTG
CATGGCTTTTATGCCGGCCTGGACCTATGATGCCTCCAAAAACGCCTGCA
CCGAGTTCATTTTCGGTGGCTGCGGTGGAAACTCCAATCAGTTCTCTACC
AAGAGTGAATGCGAAAAGGCCTGCAAGGACGCAAGCTTTCTAGACCAT

BO16903.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG3513-RA 267 CG3513-PA 1..264 17..280 1320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:23:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG3513-RA 423 CG3513-RA 15..278 17..280 1320 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:23:15
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3692844..3693029 280..95 930 100 Minus
2L 23513712 2L 3693090..3693168 95..17 395 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:23:16 has no hits.

BO16903.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:53 Download gff for BO16903.complete
Subject Subject Range Query Range Percent Splice Strand
CG3513-RA 1..267 17..284 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:19:31 Download gff for BO16903.complete
Subject Subject Range Query Range Percent Splice Strand
CG3513-RA 1..267 17..284 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:52:06 Download gff for BO16903.complete
Subject Subject Range Query Range Percent Splice Strand
CG3513-RA 15..278 17..282 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:53 Download gff for BO16903.complete
Subject Subject Range Query Range Percent Splice Strand
CG3513-RA 1..267 17..284 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:12:10 Download gff for BO16903.complete
Subject Subject Range Query Range Percent Splice Strand
CG3513-RA 15..278 17..282 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:12:10 Download gff for BO16903.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3692842..3693028 96..282 98 <- Minus
2L 3693090..3693168 17..95 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:52:06 Download gff for BO16903.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3692842..3693028 96..282 98 <- Minus
arm_2L 3693090..3693168 17..95 100   Minus

BO16903.pep Sequence

Translation from 16 to 298

> BO16903.pep
MKYIGFVAIAFLLSLSGSRLWVHAKPEMCQQPSSMVGMAQDGAACMAFMP
AWTYDASKNACTEFIFGGCGGNSNQFSTKSECEKACKDASFLDH

BO16903.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:47:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG3513-PA 88 CG3513-PA 1..88 1..88 479 100 Plus
CG16713-PA 82 CG16713-PA 8..80 6..86 168 40.2 Plus
CG16712-PB 82 CG16712-PB 1..82 1..88 158 37.5 Plus
CG16712-PA 82 CG16712-PA 1..82 1..88 158 37.5 Plus
CG2816-PB 84 CG2816-PB 40..83 45..88 141 50 Plus