Clone BO16905 Report

Search the DGRC for BO16905

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:169
Well:5
Vector:pDNR-Dual
Associated Gene/TranscriptCG17343-RA
Protein status:BO16905.pep: validated full length
Sequenced Size:286

Clone Sequence Records

BO16905.3prime Sequence

284 bp (284 high quality bases) assembled on 2006-10-13

> BO16905.3prime
ATGGTCTAGAAAGCTTGCGGTGGAGGATGTGCTGGGCTTGGTTGTGGGCT
CTGACTTGTCGGCGTCATCGTCCAGGTTCTTGCCGCTGGCCAGGAGAACA
GCTGGAACGCTGCTGGAGGTCGCCGGCAGGACTTCGCTGTCGGAAGGGGG
TGTAGGCGTCCGGGGAGTAAGCAATTGTTGGCGGTTCCTCAGGCGCTCCA
TCTTAGCCTGCTCGTACTCCTTGAGATCGGACAGCTTCAGCTGGATGGTC
TGCAGTTCGCGGCGTCGCATGTCGACTGATAACT

BO16905.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:11:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG17343-PA 255 CG17343-RA 1..252 270..19 1260 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:51:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG10702-RD 4041 CG10702-RD 3629..3880 19..270 1260 100 Plus
CG17343-RA 571 CG17343-RA 65..316 270..19 1260 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:51:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19064993..19065244 270..19 1260 100 Minus
Blast to na_te.dros performed on 2015-02-10 16:51:50 has no hits.

BO16905.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:59:05 Download gff for BO16905.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17343-PA 1..255 18..270 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 20:20:41 Download gff for BO16905.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10702-RD 3629..3880 19..270 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:05:24 Download gff for BO16905.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17343-RA 65..316 19..270 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:05:24 Download gff for BO16905.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 19064993..19065244 19..270 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 20:20:41 Download gff for BO16905.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19064993..19065244 19..270 100   Minus

BO16905.5prime Sequence

284 bp (284 high quality bases) assembled on 2006-10-13

> BO16905.5prime
GAAGTTATCAGTCGACATGCGACGCCGCGAACTGCAGACCATCCAGCTGA
AGCTGTCCGATCTCAAGGAGTACGAGCAGGCTAAGATGGAGCGCCTGAGG
AACCGCCAACAATTGCTTACTCCCCGGACGCCTACACCCCCTTCCGACAG
CGAAGTCCTGCCGGCGACCTCCAGCAGCGTTCCAGCTGTTCTCCTGGCCA
GCGGCAAGAACCTGGACGATGACGCCGACAAGTCAGAGCCCACAACCAAG
CCCAGCACATCCTCCACCGCAAGCTTTCTAGACC

BO16905.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:11:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG17343-PA 255 CG17343-RA 1..252 17..268 1260 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 11:59:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG10702-RD 4041 CG10702-RD 3629..3880 268..17 1260 100 Minus
CG17343-RA 571 CG17343-RA 65..316 17..268 1260 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 11:59:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19064993..19065244 17..268 1260 100 Plus
Blast to na_te.dros performed on 2015-02-08 11:59:17 has no hits.

BO16905.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:59:06 Download gff for BO16905.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17343-PA 1..255 17..269 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:38:42 Download gff for BO16905.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10702-RD 3629..3880 17..268 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 13:43:40 Download gff for BO16905.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17343-RA 65..316 17..268 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 13:43:40 Download gff for BO16905.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 19064993..19065244 17..268 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:38:42 Download gff for BO16905.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19064993..19065244 17..268 100   Plus

BO16905.complete Sequence

286 bp assembled on 2006-10-11

GenBank Submission: FJ633976

> BO16905.complete
GAAGTTATCAGTCGACATGCGACGCCGCGAACTGCAGACCATCCAGCTGA
AGCTGTCCGATCTCAAGGAGTACGAGCAGGCTAAGATGGAGCGCCTGAGG
AACCGCCAACAATTGCTTACTCCCCGGACGCCTACACCCCCTTCCGACAG
CGAAGTCCTGCCGGCGACCTCCAGCAGCGTTCCAGCTGTTCTCCTGGCCA
GCGGCAAGAACCTGGACGATGACGCCGACAAGTCAGAGCCCACAACCAAG
CCCAGCACATCCTCCACCGCAAGCTTTCTAGACCAT

BO16905.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG17343-RA 255 CG17343-PA 1..252 17..268 1260 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:02:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG10702-RD 4041 CG10702-RD 3629..3880 268..17 1260 100 Minus
CG17343-RA 571 CG17343-RA 65..316 17..268 1260 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:02:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19064993..19065244 17..268 1260 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:02:11 has no hits.

BO16905.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:49 Download gff for BO16905.complete
Subject Subject Range Query Range Percent Splice Strand
CG17343-RA 1..255 17..269 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:19:24 Download gff for BO16905.complete
Subject Subject Range Query Range Percent Splice Strand
CG17343-RA 1..255 17..269 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:03:04 Download gff for BO16905.complete
Subject Subject Range Query Range Percent Splice Strand
CG10702-RD 3627..3880 17..270 99   Minus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:49 Download gff for BO16905.complete
Subject Subject Range Query Range Percent Splice Strand
CG17343-RA 1..255 17..269 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:01:22 Download gff for BO16905.complete
Subject Subject Range Query Range Percent Splice Strand
CG17343-RA 65..316 17..270 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:01:22 Download gff for BO16905.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19064993..19065244 17..270 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:03:04 Download gff for BO16905.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19064993..19065244 17..270 99   Plus

BO16905.pep Sequence

Translation from 16 to 286

> BO16905.pep
MRRRELQTIQLKLSDLKEYEQAKMERLRNRQQLLTPRTPTPPSDSEVLPA
TSSSVPAVLLASGKNLDDDADKSEPTTKPSTSSTASFLDH

BO16905.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:47:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG17343-PA 84 CG17343-PA 1..84 1..84 416 100 Plus