Clone BO16916 Report

Search the DGRC for BO16916

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:169
Well:16
Vector:pDNR-Dual
Associated Gene/TranscriptCG12784-RA
Protein status:BO16916.pep: validated full length
Sequenced Size:337

Clone Sequence Records

BO16916.3prime Sequence

335 bp (335 high quality bases) assembled on 2006-10-13

> BO16916.3prime
ATGGTCTAGAAAGCTTGCCTTTGCCTTCAACTGGCAAAAAAGGCCAGATA
TAAAGTTCGTACACGATGTTAGAATATCGGGCACAGCCATGAGACCATCT
TTCATTTCCGAAAGAGTGACGAAACGGTATGCCATCAAAAGTGCCACAAT
AACCAATGTTGGTATGGCCAGAGATACCAGGATGCGAGCCACAACGACAA
TGGCAAAGCTGATCACTATCAGGGTCAGAAGAACGGCCAAGATGCGTCCC
ATTTCACCGGGCTTCACTTCACTTTTAGTCCACGCATCCAAACGGTCAAA
CACGTTTTCACCGAAATCCATGTCGACTGATAACT

BO16916.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG12784-PA 306 CG12784-RA 1..303 321..19 1515 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-03 06:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG12784-RA 437 CG12784-RA 55..357 321..19 1515 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-03 06:42:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15763169..15763471 321..19 1515 100 Minus
Blast to na_te.dros performed 2015-02-03 06:42:21
Subject Length Description Subject Range Query Range Score Percent Strand
transib2 2844 transib2 TRANSIB2 2844bp 2260..2303 302..257 108 73.9 Minus

BO16916.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:59:21 Download gff for BO16916.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12784-PA 1..306 15..321 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-09 04:30:46 Download gff for BO16916.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 52..364 11..324 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-03 07:38:47 Download gff for BO16916.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 52..364 11..324 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-03 07:38:47 Download gff for BO16916.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 15763166..15763478 11..324 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-09 04:30:46 Download gff for BO16916.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11588888..11589200 11..324 98   Minus

BO16916.5prime Sequence

335 bp (335 high quality bases) assembled on 2006-10-13

> BO16916.5prime
GAAGTTATCAGTCGACATGGATTTCGGTGAAAACGTGTTTGACCGTTTGG
ATGCGTGGACTAAAAGTGAAGTGAAGCCCGGTGAAATGGGACGCATCTTG
GCCGTTCTTCTGACCCTGATAGTGATCAGCTTTGCCATTGTCGTTGTGGC
TCGCATCCTGGTATCTCTGGCCATACCAACATTGGTTATTGTGGCACTTT
TGATGGCATACCGTTTCGTCACTCTTTCGGAAATGAAAGATGGTCTCATG
GCTGTGCCCGATATTCTAACATCGTGTACGAACTTTATATCTGGCCTTTT
TTGCCAGTTGAAGGCAAAGGCAAGCTTTCTAGACC

BO16916.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG12784-PA 306 CG12784-RA 1..303 17..319 1515 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG12784-RA 437 CG12784-RA 55..357 17..319 1515 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:15:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15763169..15763471 17..319 1515 100 Plus
Blast to na_te.dros performed 2015-02-10 16:15:47
Subject Length Description Subject Range Query Range Score Percent Strand
transib2 2844 transib2 TRANSIB2 2844bp 2260..2303 36..81 108 73.9 Plus

BO16916.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:59:22 Download gff for BO16916.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12784-PA 1..306 17..323 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-19 20:12:07 Download gff for BO16916.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 52..364 14..327 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:45:19 Download gff for BO16916.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 52..364 14..327 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:45:19 Download gff for BO16916.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 15763166..15763478 14..327 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 20:12:07 Download gff for BO16916.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11588888..11589200 14..327 98   Plus

BO16916.complete Sequence

337 bp assembled on 2006-10-11

GenBank Submission: FJ633982

> BO16916.complete
GAAGTTATCAGTCGACATGGATTTCGGTGAAAACGTGTTTGACCGTTTGG
ATGCGTGGACTAAAAGTGAAGTGAAGCCCGGTGAAATGGGACGCATCTTG
GCCGTTCTTCTGACCCTGATAGTGATCAGCTTTGCCATTGTCGTTGTGGC
TCGCATCCTGGTATCTCTGGCCATACCAACATTGGTTATTGTGGCACTTT
TGATGGCATACCGTTTCGTCACTCTTTCGGAAATGAAAGATGGTCTCATG
GCTGTGCCCGATATTCTAACATCGTGTACGAACTTTATATCTGGCCTTTT
TTGCCAGTTGAAGGCAAAGGCAAGCTTTCTAGACCAT

BO16916.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:29:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG12784-RA 306 CG12784-PA 1..303 17..319 1515 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:29:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG12784-RA 437 CG12784-RA 55..357 17..319 1515 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:29:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15763169..15763471 17..319 1515 100 Plus
Blast to na_te.dros performed 2014-11-26 16:29:33
Subject Length Description Subject Range Query Range Score Percent Strand
transib2 2844 transib2 TRANSIB2 2844bp 2260..2303 36..81 108 73.9 Plus

BO16916.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:25:52 Download gff for BO16916.complete
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 1..306 17..323 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:46:03 Download gff for BO16916.complete
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 52..364 14..327 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:02:16 Download gff for BO16916.complete
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 55..357 17..321 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:25:52 Download gff for BO16916.complete
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 52..364 14..327 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:20:27 Download gff for BO16916.complete
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 55..357 17..321 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:20:27 Download gff for BO16916.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15763169..15763471 17..321 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:02:16 Download gff for BO16916.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11588891..11589193 17..321 99   Plus

BO16916.pep Sequence

Translation from 16 to 337

> BO16916.pep
MDFGENVFDRLDAWTKSEVKPGEMGRILAVLLTLIVISFAIVVVARILVS
LAIPTLVIVALLMAYRFVTLSEMKDGLMAVPDILTSCTNFISGLFCQLKA
KASFLDH

BO16916.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG12784-PA 101 CG12784-PA 1..101 1..101 494 100 Plus