Clone BO16937 Report

Search the DGRC for BO16937

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:169
Well:37
Vector:pDNR-Dual
Associated Gene/TranscriptCG15705-RA
Protein status:BO16937.pep: validated full length
Sequenced Size:346

Clone Sequence Records

BO16937.3prime Sequence

344 bp (344 high quality bases) assembled on 2006-10-13

> BO16937.3prime
ATGGTCTAGAAAGCTTGCGTAGTTGCGATATTTTTGGGAGCTCTTCAGCT
GCTCATCCTCCGAGCGCAGCCTGCTCTCGCTCATCTTCATCTTCCAGTTT
TCCGAATAGGTCACCAGCTCCACCACCGTCTTGAATGTGACACTTTTCGA
TGGTTTAACGCCTTTCAGGAGTTTTGCCTTCTCTTTATTGCTGGGATACT
TCATGTAATCGTATTCAACCGACTGATCCGCTACCTCATCGATGATATCC
TTTTTGAACTCGACCTTCTGAGTTCCTGGATGTTTGTCCAGCTTCTTGGG
TTTTAGGCGCTGTTTTACTGGGCTGTCCATGTCGACTGATAACT

BO16937.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:11:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG15705-PA 315 CG15705-RA 1..312 330..19 1560 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 10:26:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG15705-RA 465 CG15705-RA 71..384 332..19 1570 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 10:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16281020..16281303 332..49 1420 100 Minus
Blast to na_te.dros performed on 2015-02-06 10:26:49 has no hits.

BO16937.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:59:47 Download gff for BO16937.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15705-PA 1..315 16..330 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 06:41:44 Download gff for BO16937.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15705-RA 66..395 9..339 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:26:30 Download gff for BO16937.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15705-RA 66..395 9..339 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:26:30 Download gff for BO16937.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 16281015..16281303 49..339 98 -> Minus
2R 16281519..16281559 9..48 92   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 06:41:44 Download gff for BO16937.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12168520..12168808 49..339 98 -> Minus
arm_2R 12169024..12169064 9..48 92   Minus

BO16937.5prime Sequence

344 bp (344 high quality bases) assembled on 2006-10-13

> BO16937.5prime
GAAGTTATCAGTCGACATGGACAGCCCAGTAAAACAGCGCCTAAAACCCA
AGAAGCTGGACAAACATCCAGGAACTCAGAAGGTCGAGTTCAAAAAGGAT
ATCATCGATGAGGTAGCGGATCAGTCGGTTGAATACGATTACATGAAGTA
TCCCAGCAATAAAGAGAAGGCAAAACTCCTGAAAGGCGTTAAACCATCGA
AAAGTGTCACATTCAAGACGGTGGTGGAGCTGGTGACCTATTCGGAAAAC
TGGAAGATGAAGATGAGCGAGAGCAGGCTGCGCTCGGAGGATGAGCAGCT
GAAGAGCTCCCAAAAATATCGCAACTACGCAAGCTTTCTAGACC

BO16937.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:11:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG15705-PA 315 CG15705-RA 1..312 17..328 1560 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:29:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG15705-RA 465 CG15705-RA 71..384 15..328 1570 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16281020..16281303 15..298 1420 100 Plus
Blast to na_te.dros performed on 2015-02-10 21:29:56 has no hits.

BO16937.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:59:47 Download gff for BO16937.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15705-PA 1..315 17..331 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 18:06:26 Download gff for BO16937.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15705-RA 66..395 8..338 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:42:25 Download gff for BO16937.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15705-RA 66..395 8..338 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:42:25 Download gff for BO16937.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 16281015..16281303 8..298 98 -> Plus
2R 16281519..16281559 299..338 92   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 18:06:26 Download gff for BO16937.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12168520..12168808 8..298 98 -> Plus
arm_2R 12169024..12169064 299..338 92   Plus

BO16937.complete Sequence

346 bp assembled on 2006-10-11

GenBank Submission: FJ633987

> BO16937.complete
GAAGTTATCAGTCGACATGGACAGCCCAGTAAAACAGCGCCTAAAACCCA
AGAAGCTGGACAAACATCCAGGAACTCAGAAGGTCGAGTTCAAAAAGGAT
ATCATCGATGAGGTAGCGGATCAGTCGGTTGAATACGATTACATGAAGTA
TCCCAGCAATAAAGAGAAGGCAAAACTCCTGAAAGGCGTTAAACCATCGA
AAAGTGTCACATTCAAGACGGTGGTGGAGCTGGTGACCTATTCGGAAAAC
TGGAAGATGAAGATGAGCGAGAGCAGGCTGCGCTCGGAGGATGAGCAGCT
GAAGAGCTCCCAAAAATATCGCAACTACGCAAGCTTTCTAGACCAT

BO16937.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG15705-RA 315 CG15705-PA 1..312 17..328 1560 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG15705-RA 465 CG15705-RA 71..384 15..328 1570 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16281020..16281303 15..298 1420 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:37:05 has no hits.

BO16937.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:26:04 Download gff for BO16937.complete
Subject Subject Range Query Range Percent Splice Strand
CG15705-RA 1..315 17..331 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:46:11 Download gff for BO16937.complete
Subject Subject Range Query Range Percent Splice Strand
CG15705-RA 66..395 8..338 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:55:54 Download gff for BO16937.complete
Subject Subject Range Query Range Percent Splice Strand
CG15705-RA 73..384 17..330 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:26:04 Download gff for BO16937.complete
Subject Subject Range Query Range Percent Splice Strand
CG15705-RA 66..395 8..338 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:23:35 Download gff for BO16937.complete
Subject Subject Range Query Range Percent Splice Strand
CG15705-RA 73..384 17..330 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:23:35 Download gff for BO16937.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16281022..16281303 17..298 100 -> Plus
2R 16281519..16281548 299..330 93   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:55:54 Download gff for BO16937.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12168527..12168808 17..298 100 -> Plus
arm_2R 12169024..12169053 299..330 93   Plus

BO16937.pep Sequence

Translation from 16 to 346

> BO16937.pep
MDSPVKQRLKPKKLDKHPGTQKVEFKKDIIDEVADQSVEYDYMKYPSNKE
KAKLLKGVKPSKSVTFKTVVELVTYSENWKMKMSESRLRSEDEQLKSSQK
YRNYASFLDH

BO16937.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:56:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG15705-PA 104 CG15705-PA 1..104 1..104 534 100 Plus