Clone BO16957 Report

Search the DGRC for BO16957

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:169
Well:57
Vector:pDNR-Dual
Associated Gene/TranscriptCG13426-RA
Protein status:BO16957.pep: validated full length
Sequenced Size:349

Clone Sequence Records

BO16957.3prime Sequence

347 bp (347 high quality bases) assembled on 2006-10-13

> BO16957.3prime
ATGGTCTAGAAAGCTTGCGTCCATGATGATGTTGACTATGGGTATGTGCA
TCAGCTTAACGACGAATCCAATCAAGCCCATGATAAGGAATCCTACGCCA
ATGCCAATGCTGATACGCTGGAACTCCCGACGATCTGGTTTTGTGCAGCG
CTTGTAGAACCGCAACGAGTTCTTATAGAAATCCTTGGACGGAACCATTA
AGATCAGCAGATCCTTAATCTGGCATTTAATGCGTTCCACAGACTTGCAC
TTCAAATCGGGTAAGAATTTGCGGACACTCCTCTTGGCACATTTGGCCCT
GTATCTGCGGCGACGAGAAAGTAGTTGCTCCATGTCGACTGATAACT

BO16957.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13426-PA 318 CG13426-RA 1..315 333..19 1575 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-03 06:43:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG13426-RA 418 CG13426-RA 58..372 333..19 1575 100 Minus
CG8860-RA 420 CG8860-RA 176..308 153..21 200 76.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-03 06:43:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20512743..20513006 19..282 1320 100 Plus
2R 25286936 2R 20513059..20513112 280..333 270 100 Plus
2R 25286936 2R 12179595..12179727 21..153 200 76.7 Plus
Blast to na_te.dros performed on 2015-02-03 06:43:11 has no hits.

BO16957.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:00:13 Download gff for BO16957.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13426-PA 1..318 16..333 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-09 04:30:58 Download gff for BO16957.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 58..372 19..333 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-03 07:38:53 Download gff for BO16957.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 58..372 19..333 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-03 07:38:53 Download gff for BO16957.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 20513060..20513112 281..333 100 <- Plus
2R 20512743..20513004 19..280 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-09 04:30:58 Download gff for BO16957.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16400248..16400509 19..280 100 <- Plus
arm_2R 16400565..16400617 281..333 100 <- Plus

BO16957.5prime Sequence

347 bp (347 high quality bases) assembled on 2006-10-13

> BO16957.5prime
GAAGTTATCAGTCGACATGGAGCAACTACTTTCTCGTCGCCGCAGATACA
GGGCCAAATGTGCCAAGAGGAGTGTCCGCAAATTCTTACCCGATTTGAAG
TGCAAGTCTGTGGAACGCATTAAATGCCAGATTAAGGATCTGCTGATCTT
AATGGTTCCGTCCAAGGATTTCTATAAGAACTCGTTGCGGTTCTACAAGC
GCTGCACAAAACCAGATCGTCGGGAGTTCCAGCGTATCAGCATTGGCATT
GGCGTAGGATTCCTTATCATGGGCTTGATTGGATTCGTCGTTAAGCTGAT
GCACATACCCATAGTCAACATCATCATGGACGCAAGCTTTCTAGACC

BO16957.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG13426-PA 318 CG13426-RA 1..315 17..331 1575 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 17:48:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG13426-RA 418 CG13426-RA 58..372 17..331 1575 100 Plus
CG8860-RA 420 CG8860-RA 176..308 197..329 200 76.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 17:48:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20512743..20513006 331..68 1320 100 Minus
2R 25286936 2R 20513059..20513112 70..17 270 100 Minus
2R 25286936 2R 12179595..12179727 329..197 200 76.7 Minus
Blast to na_te.dros performed on 2015-02-12 17:48:20 has no hits.

BO16957.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:00:14 Download gff for BO16957.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13426-PA 1..318 17..334 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 02:42:40 Download gff for BO16957.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 58..372 17..331 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 19:49:42 Download gff for BO16957.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 58..372 17..331 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 19:49:42 Download gff for BO16957.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 20512743..20513004 70..331 100 <- Minus
2R 20513060..20513112 17..69 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 02:42:40 Download gff for BO16957.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16400248..16400509 70..331 100 <- Minus
arm_2R 16400565..16400617 17..69 100 <- Minus

BO16957.complete Sequence

349 bp assembled on 2006-10-11

GenBank Submission: FJ633995

> BO16957.complete
GAAGTTATCAGTCGACATGGAGCAACTACTTTCTCGTCGCCGCAGATACA
GGGCCAAATGTGCCAAGAGGAGTGTCCGCAAATTCTTACCCGATTTGAAG
TGCAAGTCTGTGGAACGCATTAAATGCCAGATTAAGGATCTGCTGATCTT
AATGGTTCCGTCCAAGGATTTCTATAAGAACTCGTTGCGGTTCTACAAGC
GCTGCACAAAACCAGATCGTCGGGAGTTCCAGCGTATCAGCATTGGCATT
GGCGTAGGATTCCTTATCATGGGCTTGATTGGATTCGTCGTTAAGCTGAT
GCACATACCCATAGTCAACATCATCATGGACGCAAGCTTTCTAGACCAT

BO16957.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:41:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG13426-RA 318 CG13426-PA 1..315 17..331 1575 100 Plus
CG8860-RA 207 CG8860-PA 67..199 197..329 200 76.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:41:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG13426-RA 418 CG13426-RA 58..372 17..331 1575 100 Plus
CG8860-RA 420 CG8860-RA 176..308 197..329 200 76.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:41:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20512743..20513006 331..68 1320 100 Minus
2R 25286936 2R 20513059..20513112 70..17 270 100 Minus
2R 25286936 2R 12179595..12179727 329..197 200 76.7 Minus
Blast to na_te.dros performed on 2014-11-27 08:41:35 has no hits.

BO16957.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:05:09 Download gff for BO16957.complete
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 1..318 17..334 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:19:53 Download gff for BO16957.complete
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 58..372 17..331 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:33:12 Download gff for BO16957.complete
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 58..372 17..333 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:05:09 Download gff for BO16957.complete
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 58..372 17..331 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:24:48 Download gff for BO16957.complete
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 58..372 17..333 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:24:48 Download gff for BO16957.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20512740..20513004 70..333 99 <- Minus
2R 20513060..20513112 17..69 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:33:12 Download gff for BO16957.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16400245..16400509 70..333 99 <- Minus
arm_2R 16400565..16400617 17..69 100   Minus

BO16957.pep Sequence

Translation from 16 to 349

> BO16957.pep
MEQLLSRRRRYRAKCAKRSVRKFLPDLKCKSVERIKCQIKDLLILMVPSK
DFYKNSLRFYKRCTKPDRREFQRISIGIGVGFLIMGLIGFVVKLMHIPIV
NIIMDASFLDH

BO16957.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:47:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG13426-PA 105 CG13426-PA 1..105 1..105 538 100 Plus
Sec61gamma-PC 68 CG14214-PC 10..66 48..104 196 64.9 Plus
Sec61gamma-PB 68 CG14214-PB 10..66 48..104 196 64.9 Plus
Sec61gamma-PA 68 CG14214-PA 10..66 48..104 196 64.9 Plus
CG8860-PA 68 CG8860-PA 10..66 48..104 196 64.9 Plus