Clone BO17005 Report

Search the DGRC for BO17005

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:170
Well:5
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO17005.pep: validated full length
Sequenced Size:202

Clone Sequence Records

BO17005.5prime Sequence

200 bp (200 high quality bases) assembled on 2006-10-13

> BO17005.5prime
GAAGTTATCAGTCGACATGGAAACCTTGCAGTTATCGATTCGTCTCGCTC
ATTGCGCAATGAAAAAAATGCAGCGGGGGCGGAGGATACGAGAGAGCCTC
TCTCTTTGTGAGACACCTGCAGCGATAGGAAATGCAAATCCGCCTTCCAC
TTTCCAGCTCGAAAGTTCAAAGTTCACATGCAACGCAAGCTTTCTAGACC

BO17005.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG30055-PA 171 CG30055-RA 1..168 17..184 840 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed on 2015-02-06 10:28:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 10:28:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12590064..12590233 15..184 850 100 Plus
Blast to na_te.dros performed on 2015-02-06 10:28:35 has no hits.

BO17005.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:01:17 Download gff for BO17005.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30055-PA 1..171 17..188 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:26:42 Download gff for BO17005.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 12590064..12590243 15..196 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:26:42 Download gff for BO17005.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 12590064..12590243 15..196 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 06:42:02 Download gff for BO17005.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8477569..8477748 15..196 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 06:42:02 Download gff for BO17005.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8477569..8477748 15..196 97   Plus

BO17005.3prime Sequence

200 bp (200 high quality bases) assembled on 2006-10-13

> BO17005.3prime
ATGGTCTAGAAAGCTTGCGTTGCATGTGAACTTTGAACTTTCGAGCTGGA
AAGTGGAAGGCGGATTTGCATTTCCTATCGCTGCAGGTGTCTCACAAAGA
GAGAGGCTCTCTCGTATCCTCCGCCCCCGCTGCATTTTTTTCATTGCGCA
ATGAGCGAGACGAATCGATAACTGCAAGGTTTCCATGTCGACTGATAACT

BO17005.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG30055-PA 171 CG30055-RA 1..168 186..19 840 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed on 2015-02-10 16:26:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:26:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12590064..12590233 188..19 850 100 Minus
Blast to na_te.dros performed on 2015-02-10 16:26:05 has no hits.

BO17005.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:01:17 Download gff for BO17005.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30055-PA 1..171 15..186 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:46:56 Download gff for BO17005.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 12590064..12590243 7..188 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:46:56 Download gff for BO17005.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 12590064..12590243 7..188 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 20:13:47 Download gff for BO17005.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8477569..8477748 7..188 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 20:13:47 Download gff for BO17005.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8477569..8477748 7..188 97   Minus

BO17005.complete Sequence

202 bp assembled on 2006-10-11

GenBank Submission: FJ634009

> BO17005.complete
GAAGTTATCAGTCGACATGGAAACCTTGCAGTTATCGATTCGTCTCGCTC
ATTGCGCAATGAAAAAAATGCAGCGGGGGCGGAGGATACGAGAGAGCCTC
TCTCTTTGTGAGACACCTGCAGCGATAGGAAATGCAAATCCGCCTTCCAC
TTTCCAGCTCGAAAGTTCAAAGTTCACATGCAACGCAAGCTTTCTAGACC
AT

BO17005.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-27 07:22:05 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-27 07:22:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:22:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12590064..12590233 15..184 850 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:22:04 has no hits.

BO17005.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:57:50 Download gff for BO17005.complete
Subject Subject Range Query Range Percent Splice Strand
CG30055-RA 1..171 17..188 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:30:21 Download gff for BO17005.complete
Subject Subject Range Query Range Percent Splice Strand
CG30055-RA 762..941 15..196 97   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:57:50 Download gff for BO17005.complete
Subject Subject Range Query Range Percent Splice Strand
CG30055-RA 762..941 15..196 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:09:12 Download gff for BO17005.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12590066..12590233 17..186 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:09:12 Download gff for BO17005.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12590066..12590233 17..186 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:13:16 Download gff for BO17005.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8477571..8477738 17..186 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:13:16 Download gff for BO17005.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8477571..8477738 17..186 98   Plus

BO17005.pep Sequence

Translation from 16 to 202

> BO17005.pep
METLQLSIRLAHCAMKKMQRGRRIRESLSLCETPAAIGNANPPSTFQLES
SKFTCNASFLDH
Sequence BO17005.pep has no blast hits.