Clone Sequence Records
BO17007.5prime Sequence
233 bp (233 high quality bases) assembled on 2006-10-13
> BO17007.5prime
GAAGTTATCAGTCGACATGGATTGGATCATCAACGATGAGATGGGCCTGA
CGGTCGGTCACGTGGTGGGCTGGGCCGCCGCCTCCGCAATGGTTATTGGG
GGCGTGATCCCCTACGTGCCCCAATACATTGAGATCAAAAAAACGCAGGA
CGCGGAGGGATTCTCTCTGTACGTGTGCCTGGCGCTGCTGGTGGCCAACT
CGCTGAGAATACTCTTCGCAAGCTTTCTAGACC
BO17007.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:12:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13784-PB | 203 | CG13784-RB | 1..201 | 17..217 | 930 | 98.5 | Plus |
CG13784-PC | 783 | CG13784-RC | 1..201 | 17..217 | 930 | 98.5 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:11:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13784-RF | 3749 | CG13784-RF | 135..335 | 17..217 | 960 | 98.5 | Plus |
CG13784-RE | 3724 | CG13784-RE | 110..310 | 17..217 | 960 | 98.5 | Plus |
CG13784-RD | 5228 | CG13784-RD | 923..1123 | 17..217 | 960 | 98.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 09:11:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 7218911..7219111 | 217..17 | 960 | 98.5 | Minus |
Blast to na_te.dros performed on 2015-02-11 09:11:17 has no hits.
BO17007.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:01:19 Download gff for
BO17007.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13784-PC | 1..201 | 17..217 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 17:02:54 Download gff for
BO17007.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13784-RD | 913..1123 | 7..217 | 96 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 11:20:30 Download gff for
BO17007.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13784-RD | 913..1123 | 7..217 | 96 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 11:20:30 Download gff for
BO17007.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 7218900..7219121 | 7..225 | 95 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 17:02:54 Download gff for
BO17007.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 7218900..7219121 | 7..225 | 95 | | Minus |
BO17007.3prime Sequence
233 bp (233 high quality bases) assembled on 2006-10-13
> BO17007.3prime
ATGGTCTAGAAAGCTTGCGAAGAGTATTCTCAGCGAGTTGGCCACCAGCA
GCGCCAGGCACACGTACAGAGAGAATCCCTCCGCGTCCTGCGTTTTTTTG
ATCTCAATGTATTGGGGCACGTAGGGGATCACGCCCCCAATAACCATTGC
GGAGGCGGCGGCCCAGCCCACCACGTGACCGACCGTCAGGCCCATCTCAT
CGTTGATGATCCAATCCATGTCGACTGATAACT
BO17007.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:12:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13784-PB | 203 | CG13784-RB | 1..201 | 219..19 | 930 | 98.5 | Minus |
CG13784-PC | 783 | CG13784-RC | 1..201 | 219..19 | 930 | 98.5 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 17:49:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13784-RF | 3749 | CG13784-RF | 135..335 | 219..19 | 960 | 98.5 | Minus |
CG13784-RE | 3724 | CG13784-RE | 110..310 | 219..19 | 960 | 98.5 | Minus |
CG13784-RD | 5228 | CG13784-RD | 923..1123 | 219..19 | 960 | 98.5 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 17:49:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 7218911..7219111 | 19..219 | 960 | 98.5 | Plus |
Blast to na_te.dros performed on 2015-02-12 17:49:16 has no hits.
BO17007.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:01:17 Download gff for
BO17007.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13784-PC | 1..201 | 19..219 | 98 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 02:43:03 Download gff for
BO17007.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13784-RD | 913..1123 | 19..229 | 96 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 19:53:43 Download gff for
BO17007.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13784-RD | 913..1123 | 19..229 | 96 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 19:53:43 Download gff for
BO17007.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 7218900..7219121 | 11..229 | 95 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 02:43:03 Download gff for
BO17007.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 7218900..7219121 | 11..229 | 95 | | Plus |
BO17007.complete Sequence
235 bp assembled on 2006-10-11
GenBank Submission: FJ634010
> BO17007.complete
GAAGTTATCAGTCGACATGGATTGGATCATCAACGATGAGATGGGCCTGA
CGGTCGGTCACGTGGTGGGCTGGGCCGCCGCCTCCGCAATGGTTATTGGG
GGCGTGATCCCCTACGTGCCCCAATACATTGAGATCAAAAAAACGCAGGA
CGCGGAGGGATTCTCTCTGTACGTGTGCCTGGCGCTGCTGGTGGCCAACT
CGCTGAGAATACTCTTCGCAAGCTTTCTAGACCAT
BO17007.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:55:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13784-RF | 2520 | CG13784-PF | 1..201 | 17..217 | 960 | 98.5 | Plus |
CG13784-RE | 2520 | CG13784-PE | 1..201 | 17..217 | 960 | 98.5 | Plus |
CG13784-RD | 828 | CG13784-PD | 1..201 | 17..217 | 960 | 98.5 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:55:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13784-RF | 3749 | CG13784-RF | 135..335 | 17..217 | 960 | 98.5 | Plus |
CG13784-RE | 3724 | CG13784-RE | 110..310 | 17..217 | 960 | 98.5 | Plus |
CG13784-RD | 5228 | CG13784-RD | 923..1123 | 17..217 | 960 | 98.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:55:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 7218911..7219111 | 217..17 | 960 | 98.5 | Minus |
Blast to na_te.dros performed on 2014-11-27 08:55:50 has no hits.
BO17007.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:57:53 Download gff for
BO17007.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13784-RC | 1..201 | 17..217 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:30:22 Download gff for
BO17007.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13784-RC | 180..390 | 7..217 | 96 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:34:40 Download gff for
BO17007.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13784-RD | 923..1123 | 17..219 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:57:53 Download gff for
BO17007.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13784-RC | 180..390 | 7..217 | 96 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:28:53 Download gff for
BO17007.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13784-RD | 923..1123 | 17..219 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:28:53 Download gff for
BO17007.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 7218908..7219111 | 17..219 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:34:40 Download gff for
BO17007.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 7218908..7219111 | 17..219 | 97 | | Minus |
BO17007.pep Sequence
Translation from 16 to 235
> BO17007.pep
MDWIINDEMGLTVGHVVGWAAASAMVIGGVIPYVPQYIEIKKTQDAEGFS
LYVCLALLVANSLRILFASFLDH
BO17007.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:20:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13784-PB | 67 | CG13784-PB | 1..67 | 1..67 | 345 | 100 | Plus |
CG13784-PD | 275 | CG13784-PD | 1..67 | 1..67 | 345 | 100 | Plus |
CG13784-PC | 283 | CG13784-PC | 1..67 | 1..67 | 345 | 100 | Plus |
CG13784-PE | 839 | CG13784-PE | 1..67 | 1..67 | 345 | 100 | Plus |
CG13784-PF | 969 | CG13784-PF | 1..67 | 1..67 | 345 | 100 | Plus |