Clone BO17007 Report

Search the DGRC for BO17007

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:170
Well:7
Vector:pDNR-Dual
Associated Gene/TranscriptCG13784-RB
Protein status:BO17007.pep: validated full length
Sequenced Size:235

Clone Sequence Records

BO17007.5prime Sequence

233 bp (233 high quality bases) assembled on 2006-10-13

> BO17007.5prime
GAAGTTATCAGTCGACATGGATTGGATCATCAACGATGAGATGGGCCTGA
CGGTCGGTCACGTGGTGGGCTGGGCCGCCGCCTCCGCAATGGTTATTGGG
GGCGTGATCCCCTACGTGCCCCAATACATTGAGATCAAAAAAACGCAGGA
CGCGGAGGGATTCTCTCTGTACGTGTGCCTGGCGCTGCTGGTGGCCAACT
CGCTGAGAATACTCTTCGCAAGCTTTCTAGACC

BO17007.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG13784-PB 203 CG13784-RB 1..201 17..217 930 98.5 Plus
CG13784-PC 783 CG13784-RC 1..201 17..217 930 98.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:11:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG13784-RF 3749 CG13784-RF 135..335 17..217 960 98.5 Plus
CG13784-RE 3724 CG13784-RE 110..310 17..217 960 98.5 Plus
CG13784-RD 5228 CG13784-RD 923..1123 17..217 960 98.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 09:11:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7218911..7219111 217..17 960 98.5 Minus
Blast to na_te.dros performed on 2015-02-11 09:11:17 has no hits.

BO17007.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:01:19 Download gff for BO17007.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13784-PC 1..201 17..217 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 17:02:54 Download gff for BO17007.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13784-RD 913..1123 7..217 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 11:20:30 Download gff for BO17007.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13784-RD 913..1123 7..217 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 11:20:30 Download gff for BO17007.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 7218900..7219121 7..225 95   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 17:02:54 Download gff for BO17007.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7218900..7219121 7..225 95   Minus

BO17007.3prime Sequence

233 bp (233 high quality bases) assembled on 2006-10-13

> BO17007.3prime
ATGGTCTAGAAAGCTTGCGAAGAGTATTCTCAGCGAGTTGGCCACCAGCA
GCGCCAGGCACACGTACAGAGAGAATCCCTCCGCGTCCTGCGTTTTTTTG
ATCTCAATGTATTGGGGCACGTAGGGGATCACGCCCCCAATAACCATTGC
GGAGGCGGCGGCCCAGCCCACCACGTGACCGACCGTCAGGCCCATCTCAT
CGTTGATGATCCAATCCATGTCGACTGATAACT

BO17007.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG13784-PB 203 CG13784-RB 1..201 219..19 930 98.5 Minus
CG13784-PC 783 CG13784-RC 1..201 219..19 930 98.5 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 17:49:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG13784-RF 3749 CG13784-RF 135..335 219..19 960 98.5 Minus
CG13784-RE 3724 CG13784-RE 110..310 219..19 960 98.5 Minus
CG13784-RD 5228 CG13784-RD 923..1123 219..19 960 98.5 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 17:49:15
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7218911..7219111 19..219 960 98.5 Plus
Blast to na_te.dros performed on 2015-02-12 17:49:16 has no hits.

BO17007.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:01:17 Download gff for BO17007.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13784-PC 1..201 19..219 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 02:43:03 Download gff for BO17007.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13784-RD 913..1123 19..229 96   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 19:53:43 Download gff for BO17007.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13784-RD 913..1123 19..229 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 19:53:43 Download gff for BO17007.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 7218900..7219121 11..229 95   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 02:43:03 Download gff for BO17007.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7218900..7219121 11..229 95   Plus

BO17007.complete Sequence

235 bp assembled on 2006-10-11

GenBank Submission: FJ634010

> BO17007.complete
GAAGTTATCAGTCGACATGGATTGGATCATCAACGATGAGATGGGCCTGA
CGGTCGGTCACGTGGTGGGCTGGGCCGCCGCCTCCGCAATGGTTATTGGG
GGCGTGATCCCCTACGTGCCCCAATACATTGAGATCAAAAAAACGCAGGA
CGCGGAGGGATTCTCTCTGTACGTGTGCCTGGCGCTGCTGGTGGCCAACT
CGCTGAGAATACTCTTCGCAAGCTTTCTAGACCAT

BO17007.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:55:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG13784-RF 2520 CG13784-PF 1..201 17..217 960 98.5 Plus
CG13784-RE 2520 CG13784-PE 1..201 17..217 960 98.5 Plus
CG13784-RD 828 CG13784-PD 1..201 17..217 960 98.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:55:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13784-RF 3749 CG13784-RF 135..335 17..217 960 98.5 Plus
CG13784-RE 3724 CG13784-RE 110..310 17..217 960 98.5 Plus
CG13784-RD 5228 CG13784-RD 923..1123 17..217 960 98.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:55:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7218911..7219111 217..17 960 98.5 Minus
Blast to na_te.dros performed on 2014-11-27 08:55:50 has no hits.

BO17007.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:57:53 Download gff for BO17007.complete
Subject Subject Range Query Range Percent Splice Strand
CG13784-RC 1..201 17..217 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:30:22 Download gff for BO17007.complete
Subject Subject Range Query Range Percent Splice Strand
CG13784-RC 180..390 7..217 96   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:34:40 Download gff for BO17007.complete
Subject Subject Range Query Range Percent Splice Strand
CG13784-RD 923..1123 17..219 97   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:57:53 Download gff for BO17007.complete
Subject Subject Range Query Range Percent Splice Strand
CG13784-RC 180..390 7..217 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:28:53 Download gff for BO17007.complete
Subject Subject Range Query Range Percent Splice Strand
CG13784-RD 923..1123 17..219 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:28:53 Download gff for BO17007.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7218908..7219111 17..219 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:34:40 Download gff for BO17007.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7218908..7219111 17..219 97   Minus

BO17007.pep Sequence

Translation from 16 to 235

> BO17007.pep
MDWIINDEMGLTVGHVVGWAAASAMVIGGVIPYVPQYIEIKKTQDAEGFS
LYVCLALLVANSLRILFASFLDH

BO17007.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:20:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG13784-PB 67 CG13784-PB 1..67 1..67 345 100 Plus
CG13784-PD 275 CG13784-PD 1..67 1..67 345 100 Plus
CG13784-PC 283 CG13784-PC 1..67 1..67 345 100 Plus
CG13784-PE 839 CG13784-PE 1..67 1..67 345 100 Plus
CG13784-PF 969 CG13784-PF 1..67 1..67 345 100 Plus