Clone BO17024 Report

Search the DGRC for BO17024

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:170
Well:24
Vector:pDNR-Dual
Associated Gene/TranscriptSpec2-RA
Protein status:BO17024.pep:
Sequenced Size:289

Clone Sequence Records

BO17024.5prime Sequence

287 bp (287 high quality bases) assembled on 2006-10-13

> BO17024.5prime
GAAGTTATCAGTCGACATGGCCAGCACCGGCGAGATCTGGCTGCAGTGGT
TTTCGTGCTGCTTCCAGCAGCAGCGCTCGCCCTCCCGCCGCCCACACCAA
CGCCTGCGCATCGACCGGTCCATGATCGGCAATCCCACCAACTTCGTCCA
CACGGGCCACATCGGATCCGCGGACGTGGAGCTGTCGGCCAACCGCCTCA
ACGCGATCTCCACCCAGATGCAGAGCAAAGGCGGCTACGAGACCAACTCG
ATACACTCGCTACATGCCTGCGCAAGCTTTCTAGACC

BO17024.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG14672-PA 258 Spec2-RA 1..255 17..271 1275 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-31 10:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
Spec2-RA 1748 CG14672-RA 494..748 17..271 1275 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-01-31 10:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5618478..5618727 266..17 1250 100 Minus
Blast to na_te.dros performed on 2015-01-31 10:15:39 has no hits.

BO17024.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:01:35 Download gff for BO17024.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14672-PA 1..258 17..274 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 23:35:51 Download gff for BO17024.5prime
Subject Subject Range Query Range Percent Splice Strand
Spec2-RA 486..748 10..271 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-31 12:45:00 Download gff for BO17024.5prime
Subject Subject Range Query Range Percent Splice Strand
Spec2-RA 486..748 10..271 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-31 12:45:00 Download gff for BO17024.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 5618476..5618735 10..270 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 23:35:51 Download gff for BO17024.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1444198..1444457 10..270 97   Minus

BO17024.3prime Sequence

287 bp (287 high quality bases) assembled on 2006-10-13

> BO17024.3prime
ATGGTCTAGAAAGCTTGCGCAGGCATGTAGCGAGTGTATCGAGTTGGTCT
CGTAGCCGCCTTTGCTCTGCATCTGGGTGGAGATCGCGTTGAGGCGGTTG
GCCGACAGCTCCACGTCCGCGGATCCGATGTGGCCCGTGTGGACGAAGTT
GGTGGGATTGCCGATCATGGACCGGTCGATGCGCAGGCGTTGGTGTGGGC
GGCGGGAGGGCGAGCGCTGCTGCTGGAAGCAGCACGAAAACCACTGCAGC
CAGATCTCGCCGGTGCTGGCCATGTCGACTGATAACT

BO17024.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:12:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG14672-PA 258 Spec2-RA 1..255 273..19 1275 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:09:21
Subject Length Description Subject Range Query Range Score Percent Strand
Spec2-RA 1748 CG14672-RA 494..748 273..19 1275 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5618478..5618727 24..273 1250 100 Plus
Blast to na_te.dros performed on 2015-02-10 21:09:18 has no hits.

BO17024.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:01:34 Download gff for BO17024.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14672-PA 1..258 16..273 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 06:26:01 Download gff for BO17024.3prime
Subject Subject Range Query Range Percent Splice Strand
Spec2-RA 486..748 19..280 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:38:29 Download gff for BO17024.3prime
Subject Subject Range Query Range Percent Splice Strand
Spec2-RA 486..748 19..280 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:38:29 Download gff for BO17024.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 5618476..5618735 20..280 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 06:26:01 Download gff for BO17024.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1444198..1444457 20..280 97   Plus

BO17024.complete Sequence

289 bp assembled on 2006-10-11

GenBank Submission: FJ634015

> BO17024.complete
GAAGTTATCAGTCGACATGGCCAGCACCGGCGAGATCTGGCTGCAGTGGT
TTTCGTGCTGCTTCCAGCAGCAGCGCTCGCCCTCCCGCCGCCCACACCAA
CGCCTGCGCATCGACCGGTCCATGATCGGCAATCCCACCAACTTCGTCCA
CACGGGCCACATCGGATCCGCGGACGTGGAGCTGTCGGCCAACCGCCTCA
ACGCGATCTCCACCCAGATGCAGAGCAAAGGCGGCTACGAGACCAACTCG
ATACACTCGCTACATGCCTGCGCAAGCTTTCTAGACCAT

BO17024.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:03:57
Subject Length Description Subject Range Query Range Score Percent Strand
Spec2-RA 258 CG14672-PA 1..255 17..271 1275 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
Spec2-RA 1748 CG14672-RA 494..748 17..271 1275 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:03:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5618478..5618727 266..17 1250 100 Minus
Blast to na_te.dros performed on 2014-11-28 01:03:57 has no hits.

BO17024.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:25:14 Download gff for BO17024.complete
Subject Subject Range Query Range Percent Splice Strand
Spec2-RA 1..258 17..274 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:02:26 Download gff for BO17024.complete
Subject Subject Range Query Range Percent Splice Strand
Spec2-RA 487..749 10..271 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:37:59 Download gff for BO17024.complete
Subject Subject Range Query Range Percent Splice Strand
Spec2-RA 494..748 17..273 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:25:15 Download gff for BO17024.complete
Subject Subject Range Query Range Percent Splice Strand
Spec2-RA 487..749 10..271 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:43:38 Download gff for BO17024.complete
Subject Subject Range Query Range Percent Splice Strand
Spec2-RA 494..748 17..273 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:43:38 Download gff for BO17024.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5618473..5618727 17..273 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:37:59 Download gff for BO17024.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1444195..1444449 17..273 98   Minus

BO17024.pep Sequence

Translation from 16 to 289

> BO17024.pep
MASTGEIWLQWFSCCFQQQRSPSRRPHQRLRIDRSMIGNPTNFVHTGHIG
SADVELSANRLNAISTQMQSKGGYETNSIHSLHACASFLDH

BO17024.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
Spec2-PA 85 CG14672-PA 1..85 1..85 459 100 Plus