Clone BO17033 Report

Search the DGRC for BO17033

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:170
Well:33
Vector:pDNR-Dual
Associated Gene/TranscriptCG17278-RA
Protein status:BO17033.pep:
Sequenced Size:274

Clone Sequence Records

BO17033.3prime Sequence

272 bp (272 high quality bases) assembled on 2006-10-13

> BO17033.3prime
ATGGTCTAGAAAGCTTGCCGGACACTCCTTGTCGCTGATCTTTTGAAAGT
TTGCATTCTGGAGACAATTTTCCGTCTTCATCACGCACAGATTGCGATAG
GTCTTGGTGGAGCCCTTGTCGTCCGCAGCGCAAATGGATCGGTACTCCTG
CGTGTCGCACTCCATGACGCACTTGGTGCTGGGATCGGGCAGGCCGAGGC
ACTGGACCAGCGAGAGGGCAAGCAGCGCGATGGCCAACAATACTGCTGAG
AGCTTCATGTCGACTGATAACT

BO17033.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:12:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG17278-PA 243 CG17278-RA 1..240 258..19 1150 99.1 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-30 17:58:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG17278-RA 1934 CG17278-RA 1464..1705 260..19 1180 99.2 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-01-30 17:57:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21021405..21021584 51..230 885 99.4 Plus
Blast to na_te.dros performed on 2015-01-30 17:58:01 has no hits.

BO17033.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:01:43 Download gff for BO17033.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17278-PA 1..243 18..258 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 18:52:28 Download gff for BO17033.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17278-RA 1464..1712 12..260 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-30 20:06:58 Download gff for BO17033.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17278-RA 1464..1712 12..260 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-30 20:06:58 Download gff for BO17033.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 21021405..21021584 51..230 99 <- Plus
3R 21022671..21022700 231..260 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 18:52:28 Download gff for BO17033.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16847127..16847306 51..230 99 <- Plus
arm_3R 16848393..16848422 231..260 100   Plus

BO17033.5prime Sequence

272 bp (272 high quality bases) assembled on 2006-10-13

> BO17033.5prime
GAAGTTATCAGTCGACATGAAGCTCTCAGCAGTATTGTTGGCCATCGCGC
TGCTTGCCCTCTCGCTGGTCCAGTGCCTCGGCCTGCCCGATCCCAGCACC
AAGTGCGTCATGGAGTGCGACACGCAGGAGTACCGATCCATTTGCGCTGC
GGACGACAAGGGCTCCACCAAGACCTATCGCAATCTGTGCGTGATGAAGA
CGGAAAATTGTCTCCAGAATGCAAACTTTCAAAAGATCAGCGACAAGGAG
TGTCCGGCAAGCTTTCTAGACC

BO17033.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:12:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG17278-PA 243 CG17278-RA 1..240 17..256 1150 99.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 17:50:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG17278-RA 1934 CG17278-RA 1464..1705 15..256 1180 99.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 17:50:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21021405..21021584 224..45 885 99.4 Minus
Blast to na_te.dros performed on 2015-02-12 17:50:36 has no hits.

BO17033.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:01:44 Download gff for BO17033.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17278-PA 1..243 17..257 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 02:43:31 Download gff for BO17033.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17278-RA 1464..1712 15..263 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 19:59:09 Download gff for BO17033.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17278-RA 1464..1712 15..263 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 19:59:09 Download gff for BO17033.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 21021405..21021584 45..224 99 <- Minus
3R 21022671..21022700 15..44 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 02:43:31 Download gff for BO17033.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16847127..16847306 45..224 99 <- Minus
arm_3R 16848393..16848422 15..44 100   Minus

BO17033.complete Sequence

274 bp assembled on 2006-10-11

GenBank Submission: FJ634018

> BO17033.complete
GAAGTTATCAGTCGACATGAAGCTCTCAGCAGTATTGTTGGCCATCGCGC
TGCTTGCCCTCTCGCTGGTCCAGTGCCTCGGCCTGCCCGATCCCAGCACC
AAGTGCGTCATGGAGTGCGACACGCAGGAGTACCGATCCATTTGCGCTGC
GGACGACAAGGGCTCCACCAAGACCTATCGCAATCTGTGCGTGATGAAGA
CGGAAAATTGTCTCCAGAATGCAAACTTTCAAAAGATCAGCGACAAGGAG
TGTCCGGCAAGCTTTCTAGACCAT

BO17033.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:42:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG17278-RA 243 CG17278-PA 1..240 17..256 1170 99.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:42:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG17278-RA 1934 CG17278-RA 1464..1705 15..256 1180 99.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:42:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21021405..21021584 224..45 885 99.4 Minus
Blast to na_te.dros performed on 2014-11-27 13:42:51 has no hits.

BO17033.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:25:18 Download gff for BO17033.complete
Subject Subject Range Query Range Percent Splice Strand
CG17278-RA 1..243 17..257 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:45:38 Download gff for BO17033.complete
Subject Subject Range Query Range Percent Splice Strand
CG17278-RA 1464..1712 15..263 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:22:54 Download gff for BO17033.complete
Subject Subject Range Query Range Percent Splice Strand
CG17278-RA 1466..1705 17..258 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:25:18 Download gff for BO17033.complete
Subject Subject Range Query Range Percent Splice Strand
CG17278-RA 1464..1712 15..263 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:54:13 Download gff for BO17033.complete
Subject Subject Range Query Range Percent Splice Strand
CG17278-RA 1466..1705 17..258 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:54:13 Download gff for BO17033.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21021271..21021304 225..258 91 <- Minus
3R 21021405..21021584 45..224 99 <- Minus
3R 21022671..21022698 17..44 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:22:54 Download gff for BO17033.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16846993..16847026 225..258 91 <- Minus
arm_3R 16847127..16847306 45..224 99 <- Minus
arm_3R 16848393..16848420 17..44 100   Minus

BO17033.pep Sequence

Translation from 16 to 274

> BO17033.pep
MKLSAVLLAIALLALSLVQCLGLPDPSTKCVMECDTQEYRSICAADDKGS
TKTYRNLCVMKTENCLQNANFQKISDKECPASFLDH

BO17033.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:36:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG17278-PA 80 CG17278-PA 1..80 1..80 419 100 Plus