Clone Sequence Records
BO17159.5prime Sequence
275 bp (275 high quality bases) assembled on 2006-10-13
> BO17159.5prime
GAAGTTATCAGTCGACATGACCACGAACAGCAGCTTCTTCGATGAACACA
TCGCCATGATATACTCCAACCTGATGGACCAGTACATGCCCGAGTACTTC
AAAAGCTTTGAGTACACGCCATGGGTTTTCTCCCTGCTGGGATCGGTGGT
AATTGGACTGAGTGGCATATTCCCGCTGATCATCATTCCCACGGAGGAGA
AAATGGCTAAGGAGGGATACAAAGATCGTAAGTCACATGCGTACGAAAAG
TATATCAATGCAAGCTTTCTAGACC
BO17159.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:13:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7816-PG | 1068 | CG7816-RG | 1..211 | 17..227 | 1055 | 100 | Plus |
CG7816-PF | 1068 | CG7816-RF | 1..211 | 17..227 | 1055 | 100 | Plus |
CG7816-PD | 1068 | CG7816-RD | 1..211 | 17..227 | 1055 | 100 | Plus |
CG7816-PA | 1068 | CG7816-RA | 1..211 | 17..227 | 1055 | 100 | Plus |
CG7816-PE | 1068 | CG7816-RE | 1..211 | 17..227 | 1055 | 100 | Plus |
CG7816-PC | 1068 | CG7816-RC | 1..211 | 17..227 | 1055 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:19:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Zip99C-RJ | 1638 | CG7816-RJ | 314..524 | 17..227 | 1055 | 100 | Plus |
Zip99C-RI | 1709 | CG7816-RI | 385..595 | 17..227 | 1055 | 100 | Plus |
Zip99C-RH | 1476 | CG7816-RH | 152..362 | 17..227 | 1055 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:19:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 29865025..29865267 | 259..17 | 1215 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-12 11:19:28 has no hits.
BO17159.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:03:29 Download gff for
BO17159.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7816-PC | 1..216 | 17..235 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:47:32 Download gff for
BO17159.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7816-RH | 143..367 | 9..235 | 96 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:36:53 Download gff for
BO17159.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Zip99C-RH | 143..367 | 9..235 | 96 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:36:53 Download gff for
BO17159.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 29865018..29865262 | 22..267 | 98 | -> | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:47:32 Download gff for
BO17159.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 25690740..25690984 | 22..267 | 98 | -> | Minus |
BO17159.3prime Sequence
275 bp (275 high quality bases) assembled on 2006-10-13
> BO17159.3prime
ATGGTCTAGAAAGCTTGCATTGATATACTTTTCGTACGCATGTGACTTAC
GATCTTTGTATCCCTCCTTAGCCATTTTCTCCTCCGTGGGAATGATGATC
AGCGGGAATATGCCACTCAGTCCAATTACCACCGATCCCAGCAGGGAGAA
AACCCATGGCGTGTACTCAAAGCTTTTGAAGTACTCGGGCATGTACTGGT
CCATCAGGTTGGAGTATATCATGGCGATGTGTTCATCGAAGAAGCTGCTG
TTCGTGGTCATGTCGACTGATAACT
BO17159.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:13:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7816-PG | 1068 | CG7816-RG | 1..211 | 261..51 | 1055 | 100 | Minus |
CG7816-PF | 1068 | CG7816-RF | 1..211 | 261..51 | 1055 | 100 | Minus |
CG7816-PD | 1068 | CG7816-RD | 1..211 | 261..51 | 1055 | 100 | Minus |
CG7816-PA | 1068 | CG7816-RA | 1..211 | 261..51 | 1055 | 100 | Minus |
CG7816-PE | 1068 | CG7816-RE | 1..211 | 261..51 | 1055 | 100 | Minus |
CG7816-PC | 1068 | CG7816-RC | 1..211 | 261..51 | 1055 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-03 06:48:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Zip99C-RJ | 1638 | CG7816-RJ | 314..524 | 261..51 | 1055 | 100 | Minus |
Zip99C-RI | 1709 | CG7816-RI | 385..595 | 261..51 | 1055 | 100 | Minus |
Zip99C-RH | 1476 | CG7816-RH | 152..362 | 261..51 | 1055 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-03 06:48:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 29865025..29865267 | 19..261 | 1215 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-03 06:48:55 has no hits.
BO17159.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:03:28 Download gff for
BO17159.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7816-PC | 1..216 | 43..261 | 98 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-09 04:31:59 Download gff for
BO17159.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7816-RH | 143..367 | 43..269 | 96 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-03 07:39:42 Download gff for
BO17159.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Zip99C-RH | 143..367 | 43..269 | 96 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-03 07:39:42 Download gff for
BO17159.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 29865018..29865262 | 11..256 | 98 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-09 04:31:59 Download gff for
BO17159.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 25690740..25690984 | 11..256 | 98 | -> | Plus |
BO17159.complete Sequence
277 bp assembled on 2006-10-11
GenBank Submission: FJ634047
> BO17159.complete
GAAGTTATCAGTCGACATGACCACGAACAGCAGCTTCTTCGATGAACACA
TCGCCATGATATACTCCAACCTGATGGACCAGTACATGCCCGAGTACTTC
AAAAGCTTTGAGTACACGCCATGGGTTTTCTCCCTGCTGGGATCGGTGGT
AATTGGACTGAGTGGCATATTCCCGCTGATCATCATTCCCACGGAGGAGA
AAATGGCTAAGGAGGGATACAAAGATCGTAAGTCACATGCGTACGAAAAG
TATATCAATGCAAGCTTTCTAGACCAT
BO17159.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:39:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Zip99C-RJ | 1068 | CG7816-PJ | 1..211 | 17..227 | 1055 | 100 | Plus |
Zip99C-RI | 1068 | CG7816-PI | 1..211 | 17..227 | 1055 | 100 | Plus |
Zip99C-RH | 1068 | CG7816-PH | 1..211 | 17..227 | 1055 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:39:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Zip99C-RJ | 1638 | CG7816-RJ | 314..524 | 17..227 | 1055 | 100 | Plus |
Zip99C-RI | 1709 | CG7816-RI | 385..595 | 17..227 | 1055 | 100 | Plus |
Zip99C-RH | 1476 | CG7816-RH | 152..362 | 17..227 | 1055 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:39:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 29865025..29865267 | 259..17 | 1215 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 23:39:12 has no hits.
BO17159.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:30:18 Download gff for
BO17159.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7816-RE | 200..424 | 9..235 | 96 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:34:35 Download gff for
BO17159.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7816-RH | 152..367 | 17..235 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:57:44 Download gff for
BO17159.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7816-RE | 200..424 | 9..235 | 96 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:05:28 Download gff for
BO17159.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Zip99C-RH | 152..367 | 17..235 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:05:28 Download gff for
BO17159.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 29865022..29865267 | 17..261 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:34:35 Download gff for
BO17159.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 25690744..25690989 | 17..261 | 99 | | Minus |
BO17159.pep Sequence
Translation from 16 to 277
> BO17159.pep
MTTNSSFFDEHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG
IFPLIIIPTEEKMAKEGYKDRKSHAYEKYINASFLDH
BO17159.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:20:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Zip99C-PJ | 355 | CG7816-PJ | 1..70 | 1..70 | 368 | 100 | Plus |
Zip99C-PI | 355 | CG7816-PI | 1..70 | 1..70 | 368 | 100 | Plus |
Zip99C-PH | 355 | CG7816-PH | 1..70 | 1..70 | 368 | 100 | Plus |
Zip99C-PC | 355 | CG7816-PC | 1..70 | 1..70 | 368 | 100 | Plus |
Zip99C-PE | 355 | CG7816-PE | 1..70 | 1..70 | 368 | 100 | Plus |