Clone BO17159 Report

Search the DGRC for BO17159

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:171
Well:59
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO17159.pep: validated not full length
Sequenced Size:277

Clone Sequence Records

BO17159.5prime Sequence

275 bp (275 high quality bases) assembled on 2006-10-13

> BO17159.5prime
GAAGTTATCAGTCGACATGACCACGAACAGCAGCTTCTTCGATGAACACA
TCGCCATGATATACTCCAACCTGATGGACCAGTACATGCCCGAGTACTTC
AAAAGCTTTGAGTACACGCCATGGGTTTTCTCCCTGCTGGGATCGGTGGT
AATTGGACTGAGTGGCATATTCCCGCTGATCATCATTCCCACGGAGGAGA
AAATGGCTAAGGAGGGATACAAAGATCGTAAGTCACATGCGTACGAAAAG
TATATCAATGCAAGCTTTCTAGACC

BO17159.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:13:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG7816-PG 1068 CG7816-RG 1..211 17..227 1055 100 Plus
CG7816-PF 1068 CG7816-RF 1..211 17..227 1055 100 Plus
CG7816-PD 1068 CG7816-RD 1..211 17..227 1055 100 Plus
CG7816-PA 1068 CG7816-RA 1..211 17..227 1055 100 Plus
CG7816-PE 1068 CG7816-RE 1..211 17..227 1055 100 Plus
CG7816-PC 1068 CG7816-RC 1..211 17..227 1055 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
Zip99C-RJ 1638 CG7816-RJ 314..524 17..227 1055 100 Plus
Zip99C-RI 1709 CG7816-RI 385..595 17..227 1055 100 Plus
Zip99C-RH 1476 CG7816-RH 152..362 17..227 1055 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29865025..29865267 259..17 1215 100 Minus
Blast to na_te.dros performed on 2015-02-12 11:19:28 has no hits.

BO17159.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:03:29 Download gff for BO17159.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7816-PC 1..216 17..235 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:47:32 Download gff for BO17159.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7816-RH 143..367 9..235 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:36:53 Download gff for BO17159.5prime
Subject Subject Range Query Range Percent Splice Strand
Zip99C-RH 143..367 9..235 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:36:53 Download gff for BO17159.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 29865018..29865262 22..267 98 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:47:32 Download gff for BO17159.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25690740..25690984 22..267 98 -> Minus

BO17159.3prime Sequence

275 bp (275 high quality bases) assembled on 2006-10-13

> BO17159.3prime
ATGGTCTAGAAAGCTTGCATTGATATACTTTTCGTACGCATGTGACTTAC
GATCTTTGTATCCCTCCTTAGCCATTTTCTCCTCCGTGGGAATGATGATC
AGCGGGAATATGCCACTCAGTCCAATTACCACCGATCCCAGCAGGGAGAA
AACCCATGGCGTGTACTCAAAGCTTTTGAAGTACTCGGGCATGTACTGGT
CCATCAGGTTGGAGTATATCATGGCGATGTGTTCATCGAAGAAGCTGCTG
TTCGTGGTCATGTCGACTGATAACT

BO17159.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:13:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG7816-PG 1068 CG7816-RG 1..211 261..51 1055 100 Minus
CG7816-PF 1068 CG7816-RF 1..211 261..51 1055 100 Minus
CG7816-PD 1068 CG7816-RD 1..211 261..51 1055 100 Minus
CG7816-PA 1068 CG7816-RA 1..211 261..51 1055 100 Minus
CG7816-PE 1068 CG7816-RE 1..211 261..51 1055 100 Minus
CG7816-PC 1068 CG7816-RC 1..211 261..51 1055 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-03 06:48:58
Subject Length Description Subject Range Query Range Score Percent Strand
Zip99C-RJ 1638 CG7816-RJ 314..524 261..51 1055 100 Minus
Zip99C-RI 1709 CG7816-RI 385..595 261..51 1055 100 Minus
Zip99C-RH 1476 CG7816-RH 152..362 261..51 1055 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-03 06:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29865025..29865267 19..261 1215 100 Plus
Blast to na_te.dros performed on 2015-02-03 06:48:55 has no hits.

BO17159.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:03:28 Download gff for BO17159.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7816-PC 1..216 43..261 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-09 04:31:59 Download gff for BO17159.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7816-RH 143..367 43..269 96   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-03 07:39:42 Download gff for BO17159.3prime
Subject Subject Range Query Range Percent Splice Strand
Zip99C-RH 143..367 43..269 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-03 07:39:42 Download gff for BO17159.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 29865018..29865262 11..256 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-09 04:31:59 Download gff for BO17159.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25690740..25690984 11..256 98 -> Plus

BO17159.complete Sequence

277 bp assembled on 2006-10-11

GenBank Submission: FJ634047

> BO17159.complete
GAAGTTATCAGTCGACATGACCACGAACAGCAGCTTCTTCGATGAACACA
TCGCCATGATATACTCCAACCTGATGGACCAGTACATGCCCGAGTACTTC
AAAAGCTTTGAGTACACGCCATGGGTTTTCTCCCTGCTGGGATCGGTGGT
AATTGGACTGAGTGGCATATTCCCGCTGATCATCATTCCCACGGAGGAGA
AAATGGCTAAGGAGGGATACAAAGATCGTAAGTCACATGCGTACGAAAAG
TATATCAATGCAAGCTTTCTAGACCAT

BO17159.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:39:13
Subject Length Description Subject Range Query Range Score Percent Strand
Zip99C-RJ 1068 CG7816-PJ 1..211 17..227 1055 100 Plus
Zip99C-RI 1068 CG7816-PI 1..211 17..227 1055 100 Plus
Zip99C-RH 1068 CG7816-PH 1..211 17..227 1055 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:39:14
Subject Length Description Subject Range Query Range Score Percent Strand
Zip99C-RJ 1638 CG7816-RJ 314..524 17..227 1055 100 Plus
Zip99C-RI 1709 CG7816-RI 385..595 17..227 1055 100 Plus
Zip99C-RH 1476 CG7816-RH 152..362 17..227 1055 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:39:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29865025..29865267 259..17 1215 100 Minus
Blast to na_te.dros performed on 2014-11-27 23:39:12 has no hits.

BO17159.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:30:18 Download gff for BO17159.complete
Subject Subject Range Query Range Percent Splice Strand
CG7816-RE 200..424 9..235 96   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:34:35 Download gff for BO17159.complete
Subject Subject Range Query Range Percent Splice Strand
CG7816-RH 152..367 17..235 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:57:44 Download gff for BO17159.complete
Subject Subject Range Query Range Percent Splice Strand
CG7816-RE 200..424 9..235 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:05:28 Download gff for BO17159.complete
Subject Subject Range Query Range Percent Splice Strand
Zip99C-RH 152..367 17..235 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:05:28 Download gff for BO17159.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29865022..29865267 17..261 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:34:35 Download gff for BO17159.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25690744..25690989 17..261 99   Minus

BO17159.pep Sequence

Translation from 16 to 277

> BO17159.pep
MTTNSSFFDEHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG
IFPLIIIPTEEKMAKEGYKDRKSHAYEKYINASFLDH

BO17159.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:20:13
Subject Length Description Subject Range Query Range Score Percent Strand
Zip99C-PJ 355 CG7816-PJ 1..70 1..70 368 100 Plus
Zip99C-PI 355 CG7816-PI 1..70 1..70 368 100 Plus
Zip99C-PH 355 CG7816-PH 1..70 1..70 368 100 Plus
Zip99C-PC 355 CG7816-PC 1..70 1..70 368 100 Plus
Zip99C-PE 355 CG7816-PE 1..70 1..70 368 100 Plus